Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: helam-s4wfz6

Helicoverpa armigera (Cotton bollworm) (Heliothis armigera) Carboxyl/choline esterase CCE001g

Comment
Long C-term GN repeats excluded a little similar to the extension of bommo-b3gef7


Relationship
Family|Carb_B_Arthropoda
Block| C
Position in NCBI Life Tree|Helicoverpa armigera
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Holometabola: N E > Amphiesmenoptera: N E > Lepidoptera: N E > Glossata: N E > Neolepidoptera: N E > Heteroneura: N E > Ditrysia: N E > Obtectomera: N E > Noctuoidea: N E > Noctuidae: N E > Heliothinae: N E > Helicoverpa: N E > Helicoverpa armigera: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : KC589104
1 UniProt : S4WFZ6
1 UniProt : S4WFZ6
1 Interpro : S4WFZ6
1 Pfam : S4WFZ6
1 PIRSF : S4WFZ6
1 SUPERFAM : S4WFZ6
Sequence
Graphical view for this peptide sequence: helam-s4wfz6
Colored MSA for Carb_B_Arthropoda (raw)
MWWRTCVVLVCVTAVLADEEWRQVNTAQGPVRGQKHPSGHLYAFYNVPYA
TAPKGIHKFKAPLPPPVRTEPFDAVNKNVVCPQYIDMDSKMPGRHLEQSE
DCLIANIFVPDTNENNLPVLVYVHGGAFILGFGDMMRATQLMKSKDFIMV
TFNYRLGIHGFLCLGTEDVPGNAGLKDQVALLRWVKDNIANFGGNPNKVT
LAGYSAGSTSVDLLMLSKAAKGLFHRVIPESGANLAAFGMQRNPLEVAKS
HAKTLLFTEVEDISALEQFYKTASMGQLTAHSFLARPDSTFLFGPCVERE
TEGAFLTESPLTILKNGDYEKLPMLYGFANMEGLFRIDMFNVWKDKMNSN
FAEFLPADLKFETDGAREEVIELIKKFYFGGQPVSNDNILRYVDYFSDVP
FVYPTLRSAKLQVEAGNDQVYLYEYSFVDEKDTEVPHTNVRGADHVAQTV
ALMDGEDESRESQAYQNMRKIIREIWHNFIITGTPVPADSSLPAWPPARA
DRSPHMRLLVNPVLQGVLLGERAKFWDDIYEKYYLDAVPPAAPN
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MWWRTCVVLVCVTAVLADEEWRQVNTAQGPVRGQKHPSGHLYAFYNVPYA
TAPKGIHKFKAPLPPPVRTEPFDAVNKNVVCPQYIDMDSKMPGRHLEQSE
DCLIANIFVPDTNENNLPVLVYVHGGAFILGFGDMMRATQLMKSKDFIMV
TFNYRLGIHGFLCLGTEDVPGNAGLKDQVALLRWVKDNIANFGGNPNKVT
LAGYSAGSTSVDLLMLSKAAKGLFHRVIPESGANLAAFGMQRNPLEVAKS
HAKTLLFTEVEDISALEQFYKTASMGQLTAHSFLARPDSTFLFGPCVERE
TEGAFLTESPLTILKNGDYEKLPMLYGFANMEGLFRIDMFNVWKDKMNSN
FAEFLPADLKFETDGAREEVIELIKKFYFGGQPVSNDNILRYVDYFSDVP
FVYPTLRSAKLQVEAGNDQVYLYEYSFVDEKDTEVPHTNVRGADHVAQTV
ALMDGEDESRESQAYQNMRKIIREIWHNFIITGTPVPADSSLPAWPPARA
DRSPHMRLLVNPVLQGVLLGERAKFWDDIYEKYYLDAVPPAAPN


References
    Title: Organophosphate and pyrethroid hydrolase activities of mutant Esterases from the cotton bollworm Helicoverpa armigera
    Li Y, Farnsworth CA, Coppin CW, Teese MG, Liu JW, Scott C, Zhang X, Russell RJ, Oakeshott JG
    Ref: PLoS ONE, 8:e77685, 2013 : PubMed

            

    Title: Heterologous expression and biochemical characterisation of fourteen esterases from Helicoverpa armigera
    Teese MG, Farnsworth CA, Li Y, Coppin CW, Devonshire AL, Scott C, East P, Russell RJ, Oakeshott JG
    Ref: PLoS ONE, 8:e65951, 2013 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer