Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: hevbr-hnl

Hevea brasiliensis hydroxynitrile lyase (hnl) HbHNL mRNA, complete cds

Comment
Rubber tree hydroxynitrile lyase HbHNL. this enzyme is close to plant esterase SABP2. Few mutations can convert one activity to the other (Padhi et al. Nedrud et al.)


Relationship
Family|Hydroxynitrile_lyase
Block| X
Position in NCBI Life Tree|Hevea brasiliensis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > fabids: N E > Malpighiales: N E > Euphorbiaceae: N E > Crotonoideae: N E > Micrandreae: N E > Hevea: N E > Hevea brasiliensis: N E


Molecular evidence
Database
No mutation
19 structures (e.g. : 1QJ4, 1SC9, 1SCI... more)
No kinetic





4 substrates (e.g. : 2,3-dimethyl-2-hydroxy-butyronitrile, 4-hydroxymandelonitrile, Acetone... more)
6 inhibitors (e.g. : Acetone, Diethylene-glycol, Hexafluoracetone... more)
1 Genbank : U40402
1 UniProt : P52704
1 Ncbi-nid : 1223883
1 Ncbi-pid : 1223884
>3 Structure links 16 more: 1YAS, 2YAS, 3YAS
1 UniProt : P52704
1 Interpro : P52704
1 Pfam : P52704
1 PIRSF : P52704
1 SUPERFAM : P52704
Sequence
Graphical view for this peptide sequence: hevbr-hnl
Colored MSA for Hydroxynitrile_lyase (raw)
MAFAHFVLIHTICHGAWIWHKLKPLLEALGHKVTALDLAASGVDPRQIEE
IGSFDEYSEPLLTFLEALPPGEKVILVGESCGGLNIAIAADKYCEKIAAA
VFHNSVLPDTEHCPSYVVDKLMEVFPDWKDTTYFTYTKDGKEITGLKLGF
TLLRENLYTLCGPEEYELAKMLTRKGSLFQNILAKRPFFTKEGYGSIKKI
YVWTDQDEIFLPEFQLWQIENYKPDKVYKVEGGDHKLQLTKTKEIAEILQ
EVADTYN
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAFAHFVLIHTICHGAWIWHKLKPLLEALGHKVTALDLAASGVDPRQIEE
IGSFDEYSEPLLTFLEALPPGEKVILVGESCGGLNIAIAADKYCEKIAAA
VFHNSVLPDTEHCPSYVVDKLMEVFPDWKDTTYFTYTKDGKEITGLKLGF
TLLRENLYTLCGPEEYELAKMLTRKGSLFQNILAKRPFFTKEGYGSIKKI
YVWTDQDEIFLPEFQLWQIENYKPDKVYKVEGGDHKLQLTKTKEIAEILQ
EVADTYN


References
8 more
    Title: Three-dimensional structures of enzyme-substrate complexes of the hydroxynitrile lyase from Hevea brasiliensis
    Zuegg J, Gruber K, Gugganig M, Wagner UG, Kratky C
    Ref: Protein Science, 8:1990, 1999 : PubMed

            

    Title: Molecular cloning of the full-length cDNA of (S)-hydroxynitrile lyase from Hevea brasiliensis. Functional expression in Escherichia coli and Saccharomyces cerevisiae and identification of an active site residue
    Hasslacher M, Schall M, Hayn M, Griengl H, Kohlwein SD, Schwab H
    Ref: Journal of Biological Chemistry, 271:5884, 1996 : PubMed

            

    Title: (S)-hydroxynitrile lyase from Hevea brasiliensis
    Hasslacher M, Schall M, Hayn M, Griengl H, Kohlwein SD, Schwab H
    Ref: Annals of the New York Academy of Sciences, 799:707, 1996 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer