Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: human-ABHD17C

Homo sapiens (Human) Abhydrolase domain-containing protein FAM108C1 Q6PCB6 F108C_HUMAN

Comment
ABHD17 proteins are protein depalmitoylases that regulate N-Ras palmitate turnover and subcellular localization (Lin and Conibear 2015). ABHD17A, 17B, and 17C,are identified as the physiological PSD-95 (the most abundant postsynaptic density scaffolding protein) depalmitoylating enzymes in neurones (Yokoi et al.


Relationship
Family|ABHD17-depalmitoylase
Block| X
Position in NCBI Life Tree|Homo sapiens
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Primates: N E > Haplorrhini: N E > Simiiformes: N E > Catarrhini: N E > Hominoidea: N E > Hominidae: N E > Homininae: N E > Homo: N E > Homo sapiens: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
1 inhbitor:
Palmostatin-B
2 Genbank : AL390079, AK298606
2 UniProt : Q6PCB6, B4DQ28
2 UniProt : Q6PCB6, B4DQ28
2 Interpro : Q6PCB6, B4DQ28
2 Prodom : Q6PCB6, B4DQ28
2 Pfam : Q6PCB6, B4DQ28
2 PIRSF : Q6PCB6, B4DQ28
2 SUPERFAM : Q6PCB6, B4DQ28
1 EntrezGene : 58489
1 SNP : 58489
1 UniGene : 459072
1 HUGO HGNC : 26925
1 Ensembl : ENSG00000136379
Sequence
Graphical view for this peptide sequence: human-ABHD17C
Colored MSA for ABHD17-depalmitoylase (raw)
MPEPGPRMNGFSLGELCWLFCCPPCPSRIAAKLAFLPPEPTYTVLAPEQR
GAGASAPAPAQATAAAAAAQPAPQQPEEGAGAGPGACSLHLSERADWQYS
QRELDAVEVFFSRTARDNRLGCMFVRCAPSSRYTLLFSHGNAVDLGQMCS
FYIGLGSRINCNIFSYDYSGYGVSSGKPSEKNLYADIDAAWQALRTRYGV
SPENIILYGQSIGTVPTVDLASRYECAAVILHSPLMSGLRVAFPDTRKTY
CFDAFPSIDKISKVTSPVLVIHGTEDEVIDFSHGLAMYERCPRAVEPLWV
EGAGHNDIELYAQYLERLKQFISHELPNS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MPEPGPRMNGFSLGELCWLFCCPPCPSRIAAKLAFLPPEPTYTVLAPEQR
GAGASAPAPAQATAAAAAAQPAPQQPEEGAGAGPGACSLHLSERADWQYS
QRELDAVEVFFSRTARDNRLGCMFVRCAPSSRYTLLFSHGNAVDLGQMCS
FYIGLGSRINCNIFSYDYSGYGVSSGKPSEKNLYADIDAAWQALRTRYGV
SPENIILYGQSIGTVPTVDLASRYECAAVILHSPLMSGLRVAFPDTRKTY
CFDAFPSIDKISKVTSPVLVIHGTEDEVIDFSHGLAMYERCPRAVEPLWV
EGAGHNDIELYAQYLERLKQFISHELPNS


References
2 more
    Title: Dynamic Palmitoylation Targets MAP6 to the Axon to Promote Microtubule Stabilization during Neuronal Polarization
    Tortosa E, Adolfs Y, Fukata M, Pasterkamp RJ, Kapitein LC, Hoogenraad CC
    Ref: Neuron, 94:809, 2017 : PubMed

            

    Title: ABHD17 proteins are novel protein depalmitoylases that regulate N-Ras palmitate turnover and subcellular localization
    Lin DT, Conibear E
    Ref: Elife, 4:, 2015 : PubMed

            

    Title: Large-scale profiling of protein palmitoylation in mammalian cells
    Martin BR, Cravatt BF
    Ref: Nat Methods, 6:135, 2009 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer