Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: human-ABHD2

Homo sapiens (Human) Monoacylglycerol lipase ABHD2 LABH2 LBH2 protein phps1-2

Comment
Monoacylglycerol lipase ABHD2 Enhanced neointimal hyperplasia was observed in Abhd2-deficient mice, using an experimental vascular cuff placement injury model. Abhd2 is expressed in vascular smooth muscle cells (SMCs). An association between the human ABHD2 gene and colorectal cancer and with Risks for Chronic Obstructive Pulmonary Disease is reported. ABHD2 is a steroid-activated (progesterone P4) enzyme that hydrolyzes 2-arachidonoylglycerol. ABHD2 is expressed in sperm and in ovaries


Relationship
Family|abh_upf0017
Block| X
Position in NCBI Life Tree|Homo sapiens
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Primates: N E > Haplorrhini: N E > Simiiformes: N E > Catarrhini: N E > Hominoidea: N E > Hominidae: N E > Homininae: N E > Homo: N E > Homo sapiens: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





1 substrate:
2-Arachidonylglycerol
1 inhbitor:
Compound-183
>3 Genbank links 4 more: X12433, BC019248, BC090052
3 UniProt : P08910, A8K2S5, B4DL35
3 UniProt : P08910, A8K2S5, B4DL35
3 Interpro : P08910, A8K2S5, B4DL35
3 Prodom : P08910, A8K2S5, B4DL35
3 Pfam : P08910, A8K2S5, B4DL35
3 PIRSF : P08910, A8K2S5, B4DL35
3 SUPERFAM : P08910, A8K2S5, B4DL35
1 EntrezGene : 11057
1 SNP : 11057
1 UniGene : 122337
1 HUGO HGNC : 18717
1 OMIM : 612196
1 Ensembl : ENSG00000140526
Sequence
Graphical view for this peptide sequence: human-ABHD2
Colored MSA for abh_upf0017 (raw)
MNAMLETPELPAVFDGVKLAAVAAVLYVIVRCLNLKSPTAPPDLYFQDSG
LSRFLLKSCPLLTKEYIPPLIWGKSGHIQTALYGKMGRVRSPHPYGHRKF
ITMSDGATSTFDLFEPLAEHCVGDDITMVICPGIANHSEKQYIRTFVDYA
QKNGYRCAVLNHLGALPNIELTSPRMFTYGCTWEFGAMVNYIKKTYPLTQ
LVVVGFSLGGNIVCKYLGETQANQEKVLCCVSVCQGYSALRAQETFMQWD
QCRRFYNFLMADNMKKIILSHRQALFGDHVKKPQSLEDTDLSRLYTATSL
MQIDDNVMRKFHGYNSLKEYYEEESCMRYLHRIYVPLMLVNAADDPLVHE
SLLTIPKSLSEKRENVMFVLPLHGGHLGFFEGSVLFPEPLTWMDKLVVEY
ANAICQWERNKLQCSDTEQVEADLE
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MNAMLETPELPAVFDGVKLAAVAAVLYVIVRCLNLKSPTAPPDLYFQDSG
LSRFLLKSCPLLTKEYIPPLIWGKSGHIQTALYGKMGRVRSPHPYGHRKF
ITMSDGATSTFDLFEPLAEHCVGDDITMVICPGIANHSEKQYIRTFVDYA
QKNGYRCAVLNHLGALPNIELTSPRMFTYGCTWEFGAMVNYIKKTYPLTQ
LVVVGFSLGGNIVCKYLGETQANQEKVLCCVSVCQGYSALRAQETFMQWD
QCRRFYNFLMADNMKKIILSHRQALFGDHVKKPQSLEDTDLSRLYTATSL
MQIDDNVMRKFHGYNSLKEYYEEESCMRYLHRIYVPLMLVNAADDPLVHE
SLLTIPKSLSEKRENVMFVLPLHGGHLGFFEGSVLFPEPLTWMDKLVVEY
ANAICQWERNKLQCSDTEQVEADLE


References
14 more
    Title: Alpha/Beta Hydrolase Domain-Containing Protein 2 regulates the rhythm of follicular maturation and estrous stages of the female reproductive cycle
    Bjorkgren I, Chung DH, Mendoza S, Gabelev-Khasin L, Modzelewski A, He L, Lishko PV
    Ref: Front Cell Developmental Biology, 9:710864, 2021 : PubMed

            

    Title: Progesterone activates the cyclic AMP-protein kinase A signalling pathway by upregulating ABHD2 in fertile men
    Jiang F, Zhu Y, Chen Y, Tang X, Liu L, Chen G, Liu Y, Sun X
    Ref: J Internal Medicine Res, 49:300060521999527, 2021 : PubMed

            

    Title: ABHD2 Inhibitor Identified by Activity-Based Protein Profiling Reduces Acrosome Reaction
    Baggelaar MP, den Dulk H, Florea BI, Fazio D, Bernabo N, Raspa M, Janssen APA, Scavizzi F, Barboni B and van der Stelt M <2 more author(s)>
    Ref: ACS Chemical Biology, 14:2295, 2019 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer