Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: human-ABHD3

Homo sapiens (Human) hypothetical 49.3 kda protein

Comment
Lipase that selectively cleaves medium-chain and oxidatively truncated phospholipids Long et al. 2011


Relationship
Family|abh_upf0017
Block| X
Position in NCBI Life Tree|Homo sapiens
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Primates: N E > Haplorrhini: N E > Simiiformes: N E > Catarrhini: N E > Hominoidea: N E > Hominidae: N E > Homininae: N E > Homo: N E > Homo sapiens: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





2 substrates: C14-lysophosphatidylcholine, Dilauroyl-lecithin
2 inhibitors: ABC47, MIDA-ester-4j
1 Genbank : AF007152
1 UniProt : Q8WU67
1 UniProt : Q8WU67
1 Interpro : Q8WU67
1 Prodom : Q8WU67
1 Pfam : Q8WU67
1 PIRSF : Q8WU67
1 SUPERFAM : Q8WU67
1 EntrezGene : 171586
1 SNP : 171586
1 UniGene : 397978
1 HUGO HGNC : 18718
1 OMIM : 612197
1 Ensembl : ENSG00000158201
Sequence
Graphical view for this peptide sequence: human-ABHD3
Colored MSA for abh_upf0017 (raw)
GVGSGAASALARSRPLASRLSSRRRTRAPRSGAMQRLAMDLRMLSRELSL
YLEHQVRVGFFGSGVGLSLILGFSVAYAFYYLSSIAKKPQLVTGGESFSR
FLQDHCPVVTETYYPTVWCWEGRGQTLLRPFITSKPPVQYRNELIKTADG
GQISLDWFDNDNSTCYMDASTRPTILLLPGLTGTSKESYILHMIHLSEEL
GYRCVVFNNRGVAGENLLTPRTYCCANTEDLETVIHHVHSLYPSAPFLAA
GVSMGGMLLLNYLGKIGSKTPLMAAATFSVGWNTFACSESLEKPLNWLLF
NYYLTTCLQSSVNKHRHMFVKQVDMDHVMKAKSIREFDKRFTSVMFGYQT
IDDYYTDASPSPRLKSVGIPVLCLNSVDDVFSPSHAIPIETAKQNPNVAL
VLTSYGGHIGFLEGIWPRQSTYMDRVFKQFVQAMVEHGHELS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

GVGSGAASALARSRPLASRLSSRRRTRAPRSGAMQRLAMDLRMLSRELSL
YLEHQVRVGFFGSGVGLSLILGFSVAYAFYYLSSIAKKPQLVTGGESFSR
FLQDHCPVVTETYYPTVWCWEGRGQTLLRPFITSKPPVQYRNELIKTADG
GQISLDWFDNDNSTCYMDASTRPTILLLPGLTGTSKESYILHMIHLSEEL
GYRCVVFNNRGVAGENLLTPRTYCCANTEDLETVIHHVHSLYPSAPFLAA
GVSMGGMLLLNYLGKIGSKTPLMAAATFSVGWNTFACSESLEKPLNWLLF
NYYLTTCLQSSVNKHRHMFVKQVDMDHVMKAKSIREFDKRFTSVMFGYQT
IDDYYTDASPSPRLKSVGIPVLCLNSVDDVFSPSHAIPIETAKQNPNVAL
VLTSYGGHIGFLEGIWPRQSTYMDRVFKQFVQAMVEHGHELS


References
4 more
    Title: Multicomponent mapping of boron chemotypes furnishes selective enzyme inhibitors
    Tan J, Cognetta AB, 3rd, Diaz DB, Lum KM, Adachi S, Kundu S, Cravatt BF, Yudin AK
    Ref: Nat Commun, 8:1760, 2017 : PubMed

            

    Title: In vivo metabolite profiling as a means to identify uncharacterized lipase function: Recent success stories within the alpha beta hydrolase domain (ABHD) enzyme family
    Thomas G, Brown AL, Brown JM
    Ref: Biochimica & Biophysica Acta, 1841:1097, 2014 : PubMed

            

    Title: Metabolomics annotates ABHD3 as a physiologic regulator of medium-chain phospholipids
    Long JZ, Cisar JS, Milliken D, Niessen S, Wang C, Trauger SA, Siuzdak G, Cravatt BF
    Ref: Nat Chemical Biology, 7:763, 2011 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer