human-ABHD4

 
Homo sapiens (Human) abhydrolase domain-containing protein 4 FLJ12816 similar to 2-hydroxymuconic semialdehyde hydrolase (EC 3.1.1.-)

Relationship
Block X
Homo sapiens position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Primates: N E > Haplorrhini: N E > Simiiformes: N E > Catarrhini: N E > Hominoidea: N E > Hominidae: N E > Homininae: N E > Homo: N E > Homo sapiens: N E

Molecular evidence
Database
No mutation
No structure
No kinetic

Substrate: NAPE , Dipalmitoylphosphatidylethanolamine ,
Inhibitor: ABC47 , Methyl-arachidonyl-fluorophosphonate ,
>3 Genbank links 2 more: AK022878, BC024779, AK293198
3 UniProt : Q8TB40, B4DNZ5, B4DW04
1 Ncbi-nid : 10434527
1 Ncbi-pid : 10434528
3 UniProtTrembl : Q8TB40, B4DNZ5, B4DW04
3 Interpro : Q8TB40, B4DNZ5, B4DW04
3 Prodom : Q8TB40, B4DNZ5, B4DW04
3 Pfam : Q8TB40, B4DNZ5, B4DW04
3 PIRSF : Q8TB40, B4DNZ5, B4DW04
3 SUPERFAM : Q8TB40, B4DNZ5, B4DW04
3 QuickSwissBlast : Q8TB40, B4DNZ5, B4DW04
1 EntrezGene : 63874
1 SNP : 63874
1 UniGene : 445665
1 HUGO HGNC : 20154
1 Ensembl : ENSG00000100439
 
Sequence
Graphical view for this peptide sequence: human-ABHD4
Colored MSA for CGI-58_ABHD5_ABHD4 (raw)
MADDLEQQSQGWLSSWLPTWRPTSMSQLKNVEARILQCLQNKFLARYVSL
PNQNKIWTVTVSPEQNDRTPLVMVHGFGGGVGLWILNMDSLSARRTLHTF
DLLGFGRSSRPAFPRDPEGAEDEFVTSIETWRETMGIPSMILLGHSLGGF
LATSYSIKYPDRVKHLILVDPWGFPLRPTNPSGICAPPAWVKAVASVLGR
SNPLAVLRVAGPWGPGLVQRFRPDFKRKFADFFEDDTISEYIYHCNAQNP
SGETAFKAMMESFGWARRPMLERIHLIRKDVPITMIYGSDTWIDTSTGKK
VKMQRPDSYVRDMEIKGASHHVYADQPHIFNAVVEEICDSVD
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MADDLEQQSQGWLSSWLPTWRPTSMSQLKNVEARILQCLQNKFLARYVSL
PNQNKIWTVTVSPEQNDRTPLVMVHGFGGGVGLWILNMDSLSARRTLHTF
DLLGFGRSSRPAFPRDPEGAEDEFVTSIETWRETMGIPSMILLGHSLGGF
LATSYSIKYPDRVKHLILVDPWGFPLRPTNPSGICAPPAWVKAVASVLGR
SNPLAVLRVAGPWGPGLVQRFRPDFKRKFADFFEDDTISEYIYHCNAQNP
SGETAFKAMMESFGWARRPMLERIHLIRKDVPITMIYGSDTWIDTSTGKK
VKMQRPDSYVRDMEIKGASHHVYADQPHIFNAVVEEICDSVD

Graphical view for this nucleotide DNA sequence (2574 bp): human-ABHD4



References
6 more
    Title: ABHD4-Regulating RNA Panel: Novel Biomarkers in Acute Coronary Syndrome Diagnosis
    Agwa SHA, Elzahwy SS, El Meteini MS, Elghazaly H, Saad M, Abd Elsamee AM, Shamekh R, Matboli M
    Ref: Cells, 10:, 2021 : PubMed

            

    Title: ABHD4-dependent developmental anoikis safeguards the embryonic brain
    Laszlo ZI, Lele Z, Zoldi M, Miczan V, Mogor F, Simon GM, Mackie K, Kacskovics I, Cravatt BF, Katona I
    Ref: Nat Commun, 11:4363, 2020 : PubMed

            

    Title: Complete sequencing and characterization of 21,243 full-length human cDNAs
    Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H and Sugano S <144 more author(s)>
    Ref: Nat Genet, 36:40, 2004 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer