Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: human-ABHD6

Homo sapiens (Human) ABHD6 Monoacylglycerol lipase EC: 3.1.1.23

Comment
Monoacylglycerol lipase ABHD6 hydrolyses the endocannabinoid 2-arachidonoylglycerol (2-AG). 2-AG regulates neurotransmission and neuroinflammation by activating CB1 cannabinoid receptors on neurons and CB2 cannabinoid receptors on microglia. (A MGLL human-MGLL or MAGLL is the other enzympe hydrolyzing 26AG.(belong to Monoglyceridelipase_lysophospholip family) ABHD6 of animals is homologous to some bacterial enzymes. For bacterial enzymes, this family correspond to family V.1 of the classification of Arpigny and Jaeger 1999. Alpha/beta-Hydrolase domain 6 deletion induces adipose browning and prevents obesity and type 2 diabetes and is published by Zhao et al. A study by Wei et al. shows that ABHD6 negatively regulates the surface delivery and synaptic function of AMPA receptors independantly of hydrolase activity Q9BV23 and Q9HBL9 differ only at cterminus (alternative splicing?)Q6ZMF7 hypothetical protein flj23958


Relationship
Family|ABHD6-Lip
Block| X
Position in NCBI Life Tree|Homo sapiens
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Primates: N E > Haplorrhini: N E > Simiiformes: N E > Catarrhini: N E > Hominoidea: N E > Hominidae: N E > Homininae: N E > Homo: N E > Homo sapiens: N E


Molecular evidence
Database
>3 Genbank links 2 more: BC001698, AF225418, AK172797
>3 UniProt links 1 more: Q9BV23, C9JNE7, C9J010
1 Structure : 7OTS
>3 UniProt links 1 more: Q9BV23, Q9HBL9, C9JNE7
>3 Interpro links 1 more: Q9BV23, Q9HBL9, C9JNE7
>3 Pfam links 1 more: Q9BV23, Q9HBL9, C9JNE7
>3 PIRSF links 1 more: Q9BV23, Q9HBL9, C9JNE7
>3 SUPERFAM links 1 more: Q9BV23, Q9HBL9, C9JNE7
1 EntrezGene : 57406
1 SNP : 57406
1 HUGO HGNC : 21398
1 Ensembl : ENSG00000163686
Sequence
Graphical view for this peptide sequence: human-ABHD6
Colored MSA for ABHD6-Lip (raw)
MDLDVVNMFVIAGGTLAIPILAFVASFLLWPSALIRIYYWYWRRTLGMQV
RYVHHEDYQFCYSFRGRPGHKPSILMLHGFSAHKDMWLSVVKFLPKNLHL
VCVDMPGHEGTTRSSLDDLSIDGQVKRIHQFVECLKLNKKPFHLVGTSMG
GQVAGVYAAYYPSDVSSLCLVCPAGLQYSTDNQFVQRLKELQGSAAVEKI
PLIPSTPEEMSEMLQLCSYVRFKVPQQILQGLVDVRIPHNNFYRKLFLEI
VSEKSRYSLHQNMDKIKVPTQIIWGKQDQVLDVSGADMLAKSIANCQVEL
LENCGHSVVMERPRKTAKLIIDFLASVHNTDNNKKLD
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MDLDVVNMFVIAGGTLAIPILAFVASFLLWPSALIRIYYWYWRRTLGMQV
RYVHHEDYQFCYSFRGRPGHKPSILMLHGFSAHKDMWLSVVKFLPKNLHL
VCVDMPGHEGTTRSSLDDLSIDGQVKRIHQFVECLKLNKKPFHLVGTSMG
GQVAGVYAAYYPSDVSSLCLVCPAGLQYSTDNQFVQRLKELQGSAAVEKI
PLIPSTPEEMSEMLQLCSYVRFKVPQQILQGLVDVRIPHNNFYRKLFLEI
VSEKSRYSLHQNMDKIKVPTQIIWGKQDQVLDVSGADMLAKSIANCQVEL
LENCGHSVVMERPRKTAKLIIDFLASVHNTDNNKKLD


References
44 more
    Title: The serine hydrolase ABHD6 controls survival and thermally induced seizures in a mouse model of Dravet syndrome
    Westenbroek R, Kaplan J, Viray K, Stella N
    Ref: Neurobiol Dis, 180:106099, 2023 : PubMed

            

    Title: alpha/beta-Hydrolase Domain-Containing 6 (ABHD6)- A Multifunctional Lipid Hydrolase
    Pusch LM, Riegler-Berket L, Oberer M, Zimmermann R, Taschler U
    Ref: Metabolites, 12:, 2022 : PubMed

            

    Title: ABHD6 Controls Amphetamine-Stimulated Hyperlocomotion: Involvement of CB(1) Receptors
    Deng L, Viray K, Singh S, Cravatt B, Stella N
    Ref: Cannabis Cannabinoid Res, :, 2021 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer