human-CES4A

 
Homo sapiens (Human) Carboxylesterase 4A Carboxylesterase 8

Comment
alternative splicing. the longest sequence is Q6UX55


Relationship
Block C
Homo sapiens position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Primates: N E > Haplorrhini: N E > Simiiformes: N E > Catarrhini: N E > Hominoidea: N E > Hominidae: N E > Homininae: N E > Homo: N E > Homo sapiens: N E

Molecular evidence
Database
No mutation
No structure
No kinetic



>3 Genbank links 8 more: AK094783, AK293061, AK295483
>3 UniProt links 1 more: Q5XG92, F5GZV6, I3L191
2 Ncbi-pid : 27883886, 21753912
>3 UniProtTrembl links 2 more: Q5XG92, Q6P2E5, F5GZV6
>3 Interpro links 2 more: Q5XG92, Q6P2E5, F5GZV6
>3 Prodom links 2 more: Q5XG92, Q6P2E5, F5GZV6
>3 Pfam links 2 more: Q5XG92, Q6P2E5, F5GZV6
>3 PIRSF links 2 more: Q5XG92, Q6P2E5, F5GZV6
>3 SUPERFAM links 2 more: Q5XG92, Q6P2E5, F5GZV6
>3 QuickSwissBlast links 2 more: Q5XG92, Q6P2E5, F5GZV6
1 EntrezGene : 283848
1 SNP : 283848
1 UniGene : 346947
1 HUGO HGNC : 26741
1 Ensembl : ENSG00000172824
 
Sequence
Graphical view for this peptide sequence: human-CES4A
Colored MSA for Carb_B_Chordata (raw)
MRWILCWSLTLCLMAQTALGALHTKRPQVVTKYGTLQGKQMHVGKTPIQV
FLGVPFSRPPLGILRFAPPEPPEPWKGIRDATTYPPGCLQESWGQLASMY
VSTRERYKWLRFSEDCLYLNVYAPARAPGDPQLPVMVWFPGGAFIVGAAS
SYEGSDLAAREKVVLVFLQHRLGIFGFLSTDDSHARGNWGLLDQMAALRW
VQENIAAFGGDPGNVTLFGQSAGAMSISGLMMSPLASGLFHRAISQSGTA
LFRLFITSNPLKVAKKVAHLAGCNHNSTQILVNCLRALSGTKVMRVSNKM
RFLQLNFQRDPEEIIWSMSPVVDGVVIPDDPLVLLTQGKVSSVPYLLGVN
NLEFNWLLPYIMKFPLNRQAMRKETITKMLWSTRTLLNITKEQVPLVVEE
YLDNVNEHDWKMLRNRMMDIVQDATFVYATLQTAHYHRDAGLPVYLYEFE
HHARGIIVKPRTDGADHGDEMYFLFGGPFATGLSMGKEKALSLQMMKYWA
NFARTGNPNDGNLPCWPRYNKDEKYLQLDFTTRVGMKLKEKKMAFWMSLY
QSQRPEKQRQF
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRWILCWSLTLCLMAQTALGALHTKRPQVVTKYGTLQGKQMHVGKTPIQV
FLGVPFSRPPLGILRFAPPEPPEPWKGIRDATTYPPGCLQESWGQLASMY
VSTRERYKWLRFSEDCLYLNVYAPARAPGDPQLPVMVWFPGGAFIVGAAS
SYEGSDLAAREKVVLVFLQHRLGIFGFLSTDDSHARGNWGLLDQMAALRW
VQENIAAFGGDPGNVTLFGQSAGAMSISGLMMSPLASGLFHRAISQSGTA
LFRLFITSNPLKVAKKVAHLAGCNHNSTQILVNCLRALSGTKVMRVSNKM
RFLQLNFQRDPEEIIWSMSPVVDGVVIPDDPLVLLTQGKVSSVPYLLGVN
NLEFNWLLPYIMKFPLNRQAMRKETITKMLWSTRTLLNITKEQVPLVVEE
YLDNVNEHDWKMLRNRMMDIVQDATFVYATLQTAHYHRDAGLPVYLYEFE
HHARGIIVKPRTDGADHGDEMYFLFGGPFATGLSMGKEKALSLQMMKYWA
NFARTGNPNDGNLPCWPRYNKDEKYLQLDFTTRVGMKLKEKKMAFWMSLY
QSQRPEKQRQF

no DNA




References
1 more
    Title: The sequence and analysis of duplication-rich human chromosome 16
    Martin J, Han C, Gordon LA, Terry A, Prabhakar S, She X, Xie G, Hellsten U, Chan YM and Pennacchio LA <112 more author(s)>
    Ref: Nature, 432:988, 2004 : PubMed

            

    Title: Complete sequencing and characterization of 21,243 full-length human cDNAs
    Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H and Sugano S <144 more author(s)>
    Ref: Nat Genet, 36:40, 2004 : PubMed

            

    Title: The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment
    Clark HF, Gurney AL, Abaya E, Baker K, Baldwin D, Brush J, Chen J, Chow B, Chui C and Gray A <42 more author(s)>
    Ref: Genome Res, 13:2265, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer