human-CES5A

 
Homo sapiens (Human) est5a CES7 Cauxin Carboxylesterase-like urinary excreted protein homolog

Comment
old Acyl-CoA hydrolase precursor, medium chain (EC 3.1.2.14) XM_166284.1 is Homo sapiens expressed sequence AI266984 (LOC221223) . Q8NBC8 and Q6NT32 alternative splicing? deleted human-a8myi7 ENSG00000215478 a gene not a proteine


Relationship
Block C
Homo sapiens position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Primates: N E > Haplorrhini: N E > Simiiformes: N E > Catarrhini: N E > Hominoidea: N E > Hominidae: N E > Homininae: N E > Homo: N E > Homo sapiens: N E

Molecular evidence
Database
No mutation
No structure
No kinetic



>3 Genbank links 11 more: AY907669, AK056109, AK090997
>3 UniProt links 5 more: Q6NT32, E5RFG9, F5H0J7
1 Ncbi-nid : 20562855
1 Ncbi-pid : 20562856
>3 UniProtTrembl links 9 more: Q6NT32, E5RFG9, F5H0J7
>3 Interpro links 9 more: Q6NT32, E5RFG9, F5H0J7
>3 Prodom links 9 more: Q6NT32, E5RFG9, F5H0J7
>3 Pfam links 9 more: Q6NT32, E5RFG9, F5H0J7
>3 PIRSF links 9 more: Q6NT32, E5RFG9, F5H0J7
>3 SUPERFAM links 9 more: Q6NT32, E5RFG9, F5H0J7
>3 QuickSwissBlast links 9 more: Q6NT32, E5RFG9, F5H0J7
1 EntrezGene : 221223
1 SNP : 221223
1 UniGene : 350800
1 HUGO HGNC : 26459
1 Ensembl : ENSG00000159398
 
Sequence
Graphical view for this peptide sequence: human-CES5A
Colored MSA for Carb_B_Chordata (raw)
MSGNWVHPGQILIWAIWVLAAPTKGPSAEGPQRNTRLGWIQGKQVTVLGS
PVPVNVFLGVPFAAPPLGSLRFTNPQPASPWDNLREATSYPNLCLQNSEW
LLLDQHMLKVHYPKFGVSEDCLYLNIYAPAHADTGSKLPVLVWFPGGAFK
TGSASIFDGSALAAYEDVLVVVVQYRLGIFGFFTTWDQHAPGNWAFKDQV
AALSWVQKNIEFFGGDPSSVTIFGESAGAISVSSLILSPMAKGLFHKAIM
ESGVAIIPYLEAHDYEKSEDLQVVAHFCGNNASDSEALLRCLRTKPSKEL
LTLSQKTKSFTRVVDGAFFPNEPLDLLSQKAFKAIPSIIGVNNHECGFLL
PMKEAPEILSGSNKSLALHLIQNILHIPPQYLHLVANEYFHDKHSLTEIR
DSLLDLLGDVFFVVPALITARYHRDAGAPVYFYEFRHRPQCFEDTKPAFV
KADHADEVRFVFGGAFLKGDIVMFEGATEEEKLLSRKMMKYWATFARTGN
PNGNDLSLWPAYNLTEQYLQLDLNMSLGQRLKEPRVDFWTSTIPLILSAS
DMLHSPLSSLTFLSLLQPFFFFCAP
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSGNWVHPGQILIWAIWVLAAPTKGPSAEGPQRNTRLGWIQGKQVTVLGS
PVPVNVFLGVPFAAPPLGSLRFTNPQPASPWDNLREATSYPNLCLQNSEW
LLLDQHMLKVHYPKFGVSEDCLYLNIYAPAHADTGSKLPVLVWFPGGAFK
TGSASIFDGSALAAYEDVLVVVVQYRLGIFGFFTTWDQHAPGNWAFKDQV
AALSWVQKNIEFFGGDPSSVTIFGESAGAISVSSLILSPMAKGLFHKAIM
ESGVAIIPYLEAHDYEKSEDLQVVAHFCGNNASDSEALLRCLRTKPSKEL
LTLSQKTKSFTRVVDGAFFPNEPLDLLSQKAFKAIPSIIGVNNHECGFLL
PMKEAPEILSGSNKSLALHLIQNILHIPPQYLHLVANEYFHDKHSLTEIR
DSLLDLLGDVFFVVPALITARYHRDAGAPVYFYEFRHRPQCFEDTKPAFV
KADHADEVRFVFGGAFLKGDIVMFEGATEEEKLLSRKMMKYWATFARTGN
PNGNDLSLWPAYNLTEQYLQLDLNMSLGQRLKEPRVDFWTSTIPLILSAS
DMLHSPLSSLTFLSLLQPFFFFCAP

no DNA




References
1 more
    Title: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)
    Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R and Malek J <104 more author(s)>
    Ref: Genome Res, 14:2121, 2004 : PubMed

            

    Title: Complete sequencing and characterization of 21,243 full-length human cDNAs
    Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H and Sugano S <144 more author(s)>
    Ref: Nat Genet, 36:40, 2004 : PubMed

            

    Title: The DNA sequence of human chromosome 22
    Dunham I, Hunt AR, Collins JE, Bruskiewich R, Beare DM, Clamp M, Smink LJ, Ainscough R, Almeida JP and O'Brien KP <207 more author(s)>
    Ref: Nature, 402:489, 1999 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer