Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: human-CIB

Homo sapiens (Human) Ccg1/TafII250-Interacting Factor B CIB MGC15429 Abhydrolase domain-containing protein 14B ABHD14B. lysine deacetylase

Comment
Alpha/beta hydrolase domain-containing protein 14B. The general transcription initiation factor TFIID and its interactors play critical roles in regulating the transcription. TFIID interactor CCG1/TAF(II)250-interacting factor B (CIB) activates transcription and has hydrolase activity towards p-nitrophenyl butyrate (in vitro). ABHD14B is able to transfer an acetyl group from a post-translationally acetylated-lysine to coenzyme A (CoA) and yield acetyl-CoA, while re-generating the free amine of protein lysine residues: lysine deacetylase (Rajendran et al. 2019)


Relationship
Family|CIB-CCG1-interacting-factor-B
Block| X
Position in NCBI Life Tree|Homo sapiens
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Primates: N E > Haplorrhini: N E > Simiiformes: N E > Catarrhini: N E > Hominoidea: N E > Hominidae: N E > Homininae: N E > Homo: N E > Homo sapiens: N E


Molecular evidence
Database
No mutation
1 structure:
1IMJ: Crystal Structure Of The Human Ccg1/TafII250-Interacting Factor B (Cib)
No kinetic





2 substrates: Coenzyme-A, Paranitrophenylacetate
No inhibitor
>3 Genbank links 11 more: NM_032750, AK075034, AK075112
>3 UniProt links 4 more: Q96IU4, Q96IU4, B4DKK0
1 Ncbi-nid : 14249381
1 Ncbi-pid : 14249382
1 Structure : 1IMJ
>3 UniProt links 3 more: Q96IU4, B4DKK0, B4DNR3
>3 Interpro links 3 more: Q96IU4, B4DKK0, B4DNR3
>3 Pfam links 3 more: Q96IU4, B4DKK0, B4DNR3
>3 PIRSF links 3 more: Q96IU4, B4DKK0, B4DNR3
>3 SUPERFAM links 3 more: Q96IU4, B4DKK0, B4DNR3
1 EntrezGene : 84836
1 SNP : 84836
1 HUGO HGNC : 28235
1 Ensembl : ENSG00000114779
Sequence
Graphical view for this peptide sequence: human-CIB
Colored MSA for CIB-CCG1-interacting-factor-B (raw)
MAASVEQREGTIQVQGQALFFREALPGSGQARFSVLLLHGIRFSSETWQN
LGTLHRLAQAGYRAVAIDLPGLGHSKEAAAPAPIGELAPGSFLAAVVDAL
ELGPPVVISPSLSGMYSLPFLTAPGSQLPGFVPVAPICTDKINAANYASV
KTPALIVYGDQDPMGQTSFEHLKQLPNHRVLIMKGAGHPCYLDKPEEWHT
GLLDFLQGLQ
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAASVEQREGTIQVQGQALFFREALPGSGQARFSVLLLHGIRFSSETWQN
LGTLHRLAQAGYRAVAIDLPGLGHSKEAAAPAPIGELAPGSFLAAVVDAL
ELGPPVVISPSLSGMYSLPFLTAPGSQLPGFVPVAPICTDKINAANYASV
KTPALIVYGDQDPMGQTSFEHLKQLPNHRVLIMKGAGHPCYLDKPEEWHT
GLLDFLQGLQ


References
2 more
    Title: A multi-omics analysis reveals that the lysine deacetylase ABHD14B influences glucose metabolism in mammals
    Rajendran A, Soory A, Khandelwal N, Ratnaparkhi G, Kamat SS
    Ref: Journal of Biological Chemistry, 298:102128, 2022 : PubMed

            

    Title: Functional Annotation of ABHD14B, an Orphan Serine Hydrolase Enzyme
    Rajendran A, Vaidya K, Mendoza J, Bridwell-Rabb J, Kamat SS
    Ref: Biochemistry, 59:183, 2020 : PubMed

            

    Title: Purification, crystallization and preliminary X-ray crystallographic analysis of human CCG1-interacting factor B
    Padmanabhan B, Kuzuhara T, Mizuno H, Horikoshi M
    Ref: Acta Crystallographica D Biol Crystallogr, 56:1479, 2000 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer