Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: human-CPVL

Homo sapiens (Human) carboxypeptidase, vitellogenic-like CP-Mac ou CPVL carboxypeptidase WUG

Comment
AX083419 Sequence 111 from Patent WO0112660 differs of 1 aa from AF106704 Genbank AF282617 10180964 Trembl Q9HB41 Vitellogenic carboxypeptidase-like proteingene HVLP also differs of 1 aa Q8NBL7 differs by 5. Genbank AC005162 wugsc:h_rg113d17.1 protein (fragment) also differs of 2 aa. Homo sapiens (Human) uncharacterized bone marrow protein bm031 Trembl Q9NZ90 may be also the same


Relationship
Family|Carboxypeptidase_S10
Block| X
Position in NCBI Life Tree|Homo sapiens
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Primates: N E > Haplorrhini: N E > Simiiformes: N E > Catarrhini: N E > Hominoidea: N E > Hominidae: N E > Homininae: N E > Homo: N E > Homo sapiens: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 8 more: AF106704, AX083419, AF282617
>3 UniProt links 6 more: O75225, Q9NZ90, Q75MM4
3 Ncbi-nid : 11559511, 10180963, 13185256
>3 Ncbi-pid links 2 more: 11559512, 12060148, 12060147
>3 UniProt links 6 more: Q9H3G5, O75225, Q9NZ90
>3 Interpro links 6 more: Q9H3G5, O75225, Q9NZ90
>3 Prodom links 6 more: Q9H3G5, O75225, Q9NZ90
>3 Pfam links 6 more: Q9H3G5, O75225, Q9NZ90
>3 PIRSF links 6 more: Q9H3G5, O75225, Q9NZ90
>3 SUPERFAM links 6 more: Q9H3G5, O75225, Q9NZ90
1 EntrezGene : 54504
1 SNP : 54504
1 UniGene : 233389
1 HUGO HGNC : 14399
1 IUPHAR : 1583
1 OMIM : 609780
1 Ensembl : ENSG00000106066
Sequence
Graphical view for this peptide sequence: human-CPVL
Colored MSA for Carboxypeptidase_S10 (raw)
MVGAMWKVIVSLVLLMPGPCDGLFRSLYRSVSMPPKGDSGQPLFLTPYIE
AGKIQKGRELSLVGPFPGLNMKSYAGFLTVNKTNNSNLFFWFFPAQIQPE
DAPVVLWLQGGPGGSSMFGLFVEHGPYVVTSNMTLRDRDFPWTTTLSMLY
IDNPVGTGFSFTDDTHGYAVNEDDVARDLYSALIQFFQIFPEYKNNDFYV
TGESYAGKYVPAIAHLIHSLNPVREVKINLNGIAIGDGYSDPESIIGGYA
EFLYQIGLLDEKQKKYFQKQCHECIEHIRKQNWLEAFEILDKLLEGDLTS
DPSYFQNVTGCSNYYNFLRCTEPEDQLYYVKFLSLPEVRQAIHVGNQTFN
DGTIVEKYLREDTVQSVKPWLTEIMNNYKVLIYNGQLDIIVAAALTEHSL
MGMDWKGSQEYKKAEKKVWKIFKSDSEVAGYIRQAGDFHQVIIRGGGHIL
PYDQPLRAFDMINRFIYGKGWDPYVG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MVGAMWKVIVSLVLLMPGPCDGLFRSLYRSVSMPPKGDSGQPLFLTPYIE
AGKIQKGRELSLVGPFPGLNMKSYAGFLTVNKTNNSNLFFWFFPAQIQPE
DAPVVLWLQGGPGGSSMFGLFVEHGPYVVTSNMTLRDRDFPWTTTLSMLY
IDNPVGTGFSFTDDTHGYAVNEDDVARDLYSALIQFFQIFPEYKNNDFYV
TGESYAGKYVPAIAHLIHSLNPVREVKINLNGIAIGDGYSDPESIIGGYA
EFLYQIGLLDEKQKKYFQKQCHECIEHIRKQNWLEAFEILDKLLEGDLTS
DPSYFQNVTGCSNYYNFLRCTEPEDQLYYVKFLSLPEVRQAIHVGNQTFN
DGTIVEKYLREDTVQSVKPWLTEIMNNYKVLIYNGQLDIIVAAALTEHSL
MGMDWKGSQEYKKAEKKVWKIFKSDSEVAGYIRQAGDFHQVIIRGGGHIL
PYDQPLRAFDMINRFIYGKGWDPYVG


References
    Title: Complete sequencing and characterization of 21,243 full-length human cDNAs
    Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H and Sugano S <144 more author(s)>
    Ref: Nat Genet, 36:40, 2004 : PubMed

            

    Title: The DNA sequence of human chromosome 7
    Hillier LW, Fulton RS, Fulton LA, Graves TA, Pepin KH, Wagner-McPherson C, Layman D, Maas J, Jaeger S and Wilson RK <97 more author(s)>
    Ref: Nature, 424:157, 2003 : PubMed

            

    Title: Cloning and characterization of CPVL, a novel serine carboxypeptidase, from human macrophages
    Mahoney JA, Ntolosi B, DaSilva RP, Gordon S, McKnight AJ
    Ref: Genomics, 72:243, 2001 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer