human-CPVL
Homo sapiens (Human) carboxypeptidase, vitellogenic-like CP-Mac ou CPVL carboxypeptidase WUG
Comment
AX083419 Sequence 111 from Patent WO0112660 differs of 1 aa from AF106704 Genbank AF282617 10180964 Trembl Q9HB41 Vitellogenic carboxypeptidase-like proteingene HVLP also differs of 1 aa Q8NBL7 differs by 5. Genbank AC005162 wugsc:h_rg113d17.1 protein (fragment) also differs of 2 aa. Homo sapiens (Human) uncharacterized bone marrow protein bm031 Trembl Q9NZ90 may be also the same Relationship
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain. > cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Primates: N E > Haplorrhini: N E > Simiiformes: N E > Catarrhini: N E > Hominoidea: N E > Hominidae: N E > Homininae: N E > Homo: N E > Homo sapiens: N E
A85-EsteraseD-FGH :
human-ESD Homo sapiens (Human) esterase D (EC 3.1.1.1) formylglutathione hydrolase.
ABHD6-Lip :
human-ABHD6 Homo sapiens (Human) ABHD6 Monoacylglycerol lipase EC: 3.1.1.23.
ABHD8 :
human-ABHD8 Homo sapiens (Human) Abhydrolase domain containing 8 (ABHD8) cDNA FLJ11743 fis, clone HEMBA1005517 .
ABHD10 :
human-ABHD10 Homo sapiens (Human) ABHDA ABHD10 Abhydrolase domain-containing protein 10, Mycophenolic acid acyl-glucuronide esterase, mitochondrial .
ABHD11-Acetyl_transferase :
human-ABHD11 Homo sapiens (Human) (EC 3.3.2.3) Abhydrolase domain-containing protein 11 williams-beuren syndrome critical region protein 21 .
ABHD12-PHARC :
human-ABHD12 Homo sapiens (Human) abhydrolase domain-containing protein 12. Protein C20orf22, flj90542, CT022, 2-arachidonoylglycerol hydrolase, Monoacylglycerol lipase ,
human-ABHD12B Homo sapiens (Human) Abhydrolase domain-containing protein 12B ABHD12B protein c14orf29 .
ABHD13-BEM46 :
human-ABHD13 Homo sapiens (Human) C13orf6 Q7L211 ABHDD_HUMAN ABHD13 Abhydrolase domain-containing protein 13 .
ABHD16 :
human-ABHD16A Homo sapiens (Human) Abhydrolase domain-containing protein 16A BAT5 (HLA-B-associated transcript 5) (NG26 protein) (G5) (PP199) ,
human-ABHD16B Homo sapiens (Human) ABHD16B hypothetical protein c20orf135 ct135 .
ABHD17-depalmitoylase :
human-ABHD17A Homo sapiens (Human) Abhydrolase domain-containing protein FAM108A1, C19orf27 ABHD17A ,
human-ABHD17B Homo sapiens (Human) CGI-67 C9orf77 FAM108B1 protein Abhydrolase domain-containing protein FAM108B1 ,
human-ABHD17C Homo sapiens (Human) Abhydrolase domain-containing protein FAM108C1 Q6PCB6 F108C_HUMAN .
ABHD18 :
human-ABHD18 Homo sapiens (Human) ABHD18 C4orf29 CD029 hypothetical protein .
abh_upf0017 :
human-ABHD1 Homo sapiens (Human) lung alpha/beta hydrolase 1 ,
human-ABHD2 Homo sapiens (Human) Monoacylglycerol lipase ABHD2 LABH2 LBH2 protein phps1-2 ,
human-ABHD3 Homo sapiens (Human) hypothetical 49.3 kda protein ,
human-ABHD15 Homo sapiens (Human) ABH15 Abhydrolase domain-containing protein 15 hypothetical protein .
ACHE :
human-ACHE Homo sapiens (Human) acetylcholinesterase.
Acidic_Lipase :
human-LIPA Homo sapiens (Human) lysosomal acid lipase LICH_HUMAN gene LIPA, Lysosomal acid lipase/cholesteryl ester hydrolase (EC:3.1.1.13) LAL cholesterol esterase (wolman disease) Sebelipase,
human-LIPF Homo sapiens (Human) human gastric lipase,
human-LIPJ Homo sapiens (Human) Lipase member J lipase-like, ab-hydrolase domain containing 1 ,
human-LIPK Homo sapiens (Human) Lipase member K lipase-like, ab-hydrolase domain containing 2 LIPL2 ,
human-LIPM Homo sapiens (Human) LIPM LIPL3 ba304i5.1 ,
human-LIPN Homo sapiens (Human) lipase-like, Lipase-like abhydrolase domain-containing protein 4 .
ACPH_Peptidase_S9 :
human-APEH Homo sapiens (Human) acylamino acid-releasing enzyme .
Acyl-CoA_Thioesterase :
human-ACOT1 Homo sapiens (Human) Inducible cytosolic acyl-coenzyme A thioester hydrolase Long chain Acyl-CoA hydrolase) (cte-i) (cte-ib) ,
human-ACOT2 Homo sapiens (Human) peroxisomal long-chain Acyl-CoA thioesterase 2 (zap128) (protein for mgc:3983) mitochondrial (EC 3.1.2.2) CTE-1a,
human-ACOT4 Homo sapiens (Human) Q8N9L9 Acyl-coenzyme A thioesterase 4, inducible (EC 3.1.2.2),
human-ACOT6 Homo sapiens (Human) Acyl-CoA thioesterase 6 (EC 3.1.2.2) ,
human-BAAT Homo sapiens (Human) bile acid CoA: amino acid n-acyltransferase (EC 3.1.2.2) .
Arb2_FAM172A :
human-f172a Homo sapiens (Human). Protein FAM172A .
Arylacetamide_deacetylase :
human-AADAC Homo sapiens (Human) arylacetamide deacetylase ,
human-AADACL2 Homo sapiens (Human) similar to arylacetamide deacetylase (aadac) ,
human-AADACL3 Homo sapiens (Human) AADACL3 arylacetamide deacetylase-like 3 ADCL3 ,
human-AADACL4 Homo sapiens (Human) Arylacetamide deacetylase-like 4 ,
human-NCEH1 Homo sapiens (Human) NCEH1 KIAA1363 AADACL1 neutral cholesterol ester hydrolase 1 .
BCHE :
human-BCHE Homo sapiens (Human) butyrylcholinesterase.
Carboxypeptidase_S10 :
human-CTSA Homo sapiens (Human) protective protein associated with lysosomal beta-galactosidase ppt2 protein CTSA Cathepsin A, PPGB,
human-SCPEP1 Homo sapiens (Human) serine Retinoid-inducible serine carboxypeptidase RISC SCP1 (EC 3.4.16.-) .
Carb_B_Chordata :
human-CES1 Homo sapiens (Human) carboxylesterase CES1 hCE1 & for monocyte/macrophage serine-esterase 1 egasyn,
human-CES2 Homo sapiens (Human) carboxylesterase hCE-2,iCE, hiCE, CES2 gene cDNA FLJ76104 Cocaine esterase ,
human-CES3 Homo sapiens (Human) Carboxylesterase 3 (Brain) Liver carboxylesterase 31 homolog ,
human-CES4A Homo sapiens (Human) Carboxylesterase 4A Carboxylesterase 8 ,
human-CES5A Homo sapiens (Human) est5a CES7 Cauxin Carboxylesterase-like urinary excreted protein homolog .
CGI-58_ABHD5_ABHD4 :
human-ABHD4 Homo sapiens (Human) abhydrolase domain-containing protein 4 FLJ12816 similar to 2-hydroxymuconic semialdehyde hydrolase (EC 3.1.1.-) ,
human-ABHD5 Homo sapiens (Human) 39.1 kDa Comparative gene identification 58 (CGI-58)/Alpha Beta Hydrolase Domain 5 (ABHD5).
Cholesterol_esterase :
human-CEL Homo sapiens (Human) bile-salt-activated lipase, BSSL BAL CEL CEH carboxyl ester lipase chr 9.
CIB-CCG1-interacting-factor-B :
human-ABHD14A Homo sapiens (Human) Abhydrolase domain-containing protein 14A srsq1913 ,
human-CIB Homo sapiens (Human) Ccg1/TafII250-Interacting Factor B CIB MGC15429 Abhydrolase domain-containing protein 14B ABHD14B. lysine deacetylase.
CMBL :
human-CMBL Homo sapiens (Human) Carboxymethylenebutenolidase homolog .
DPP4N_Peptidase_S9 :
human-DPP4 Homo sapiens (Human) dipeptidyl peptidase IV (DPP4), T-cell activation antigen CD26,
human-DPP6 Homo sapiens (Human) (dipeptidylpeptidase VI) (dppx),
human-DPP8 Homo sapiens (Human) dipeptidyl peptidase 8 (DPP8),
human-DPP9 Homo sapiens (Human) dipeptidyl peptidase 9 DPP9 DPRP2,
human-DPP10 Homo sapiens (Human) DPP-10 Dipeptidyl peptidase IV-related protein-3 KIAA1492 protein (fragment),
human-FAP Homo sapiens (Human) fibroblast activation protein alpha FAPalpha, integral membrane serine protease seprase FAPA, FAP, SEPR.
Duf_676 :
human-FAM135A Homo sapiens (Human) F135A DKFZp781H2319 FLJ20176 fis KIAA1411 previously human-F135A ,
human-FAM135B Homo sapiens (Human) F135B loc51059 c8orfk32 protein .
Duf_726 :
human-TMCO4 Homo sapiens (Human) Transmembrane and coiled-coil domain-containing protein 4 .
Duf_829 :
human-TMEM53 Homo sapiens (Human) Transmembrane protein 53, FLJ22353, NET4 .
Epoxide_hydrolase :
human-EPHX1 Homo sapiens (Human) microsomal epoxide hydrolase HYEP mEH, epoxide hydratase EPHX1 ,
human-EPHX2 Homo sapiens (Human) epoxide hydrolase 2, Bifunctional epoxide hydrolase 2 cytosolic (EPHX2) (EC 3.3.2.3) Lipid-phosphate phosphatase (EC 3.1.3.76),
human-EPHX3 Homo sapiens (Human) Epoxide hydrolase 3 (EPHX3) Abhydrolase domain-containing protein 9 (ABHD9) FLJ22408 ,
human-EPHX4 Homo sapiens (Human) Epoxide hydrolase 4 EPHX4 ABHD7 EPHXRP Abhydrolase domain-containing protein 7 .
FSH1 :
human-OVCA2 Homo sapiens (Human) Candidate tumor suppressor in ovarian cancer .
Hepatic_Lipase :
human-LIPC Homo sapiens (Human) LIPC hepatic triacylglycerol lipase HTGL .
Hormone-sensitive_lipase_like :
human-LIPE Human mRNA (Human) hormone sensitive lipase HSL .
Hydrolase_RBBP9_YdeN :
human-RBBP9 Homo sapiens (Human) Retinoblastoma-binding protein 9 and 10 (rbbp-10) (b5t overexpressed gene protein) (bog protein).
Kynurenine-formamidase :
human-AFMID Homo sapiens (Human) Kynurenine formamidase .
LIDHydrolase :
human-LDAH Homo sapiens (Human) lipid droplet-associated hydrolase (LDAH) C2orf43 .
Lipase_3 :
human-DAGLA Homo sapiens (Human) DAGLA Sn1-specific diacylglycerol lipase alpha DGL-alpha, neural stem cell-derived dendrite regulator KIAA0659 ,
human-DAGLB Homo sapiens (Human) DAGLB Sn1-specific diacylglycerol lipase beta kccr13l FLJ36639 .
Lipoprotein_Lipase :
human-LIPG Homo sapiens (Human) endothelial lipase LIPE_HUMAN flj43354 ,
human-LPL Homo sapiens (Human) Lipoprotein lipase LPL, LIPD.
LYsophospholipase_carboxylesterase :
human-LYPLA1 Homo sapiens (Human) lysophospholipase I (LYPLA1) APT1, acyl-protein thioesterase 1 S-depalmitoylase,
human-LYPLA2 Homo sapiens (Human) acyl-protein thioesterase dJ886K2.4 lysophospholipase II APT2,
human-LYPLAL1 Homo sapiens (Human) LYPLAL1 26.3 kda protein lysophospholipase-like 1.
Maspardin-ACP33-SPG21_like :
human-SPG21 Homo sapiens (Human) Maspardin spg21 acid cluster protein 33 ACP33 sbm-019 (gl010)flj24010 Maspardin .
MEST-like :
human-MEST Homo sapiens (Human) MEST mesoderm-specific transcript .
Monoglyceridelipase_lysophospholip :
human-MGLL Homo sapiens (Human) Monoglyceride lipase (MAGL) lysophospholipase homolog.
Ndr_family :
human-NDRG1 Homo sapiens (Human) N-myc downstream-regulated gene 1 protein (cap43,rit42, ndr1 DRG1, PROXY1, RTP, TDD5),
human-NDRG2 Homo sapiens (Human) ndrg2 protein N-myc downstream-regulated gene 2 protein (syld709613 protein) ndr1-related protein 2,
human-NDRG3 Homo sapiens (Human) ndrg3 protein ndr1-related development protein ndr3 otthump00000030883 otthump00000030882,
human-NDRG4 Homo sapiens (Human) NDRG4, N-myc downstream-regulated gene 4 protein (smap-8) flj42011 flj16174 flj44611 .
Neuroligin :
human-NLGN1 Homo sapiens (Human) Neuroligin 1 KIAA1070 protein,
human-NLGN2 Homo sapiens (Human) neuroligin 2 (KIAA1366),
human-NLGN3 Homo sapiens (Human) Neuroligin 3 KIAA1480 ,
human-NLGN4X Homo sapiens (Human) Neuroligin-4, X-linked (HNLX) Neuroligin4 KIAA0951,
human-NLGN4Y Homo sapiens (Human) Neuroligin-4, Y-linked precursor (Neuroligin Y) KIAA0951 .
NLS3-Tex30 :
human-KANSL3 Homo sapiens (Human) KAT8 regulatory NSL complex subunit 3, Testis development protein PRTD, KIAA1310, PRTD, SI1, FLJ10081, NSL3, Rcd1 ,
human-TEX30 Homo sapiens (Human) testis expressed 30 C13orf27 chromosome 13 open reading frame 27 .
PAF-Acetylhydrolase :
human-PAFAH2 Homo sapiens (Human) (EC 3.1.1.47) platelet-activating factor acetylhydrolase 2, cytoplasmic (serine dependent phospholipase a2) (hsd-pla2), PAFAH2, PAFA2 PAF-AH ,
human-PLA2G7 Homo sapiens (Human) plasma PAF acetylhydrolase Phospholipase A2 groupe 7 PLA2G7 PAFAH PAF-AH Lp-PLA(2).
Palmitoyl-protein_thioesterase :
human-PPT1 Homo sapiens (Human) palmitoyl-protein thioesterase (PPT),
human-PPT2 Homo sapiens (Human) 34.9 kda protein (palmitoyl-protein thioesterase-2).
Pancreatic_lipase :
human-PNLIP Homo sapiens (Human) triacylglycerol lipase (pancreatic lipase),
human-PNLIPRP1 Homo sapiens (Human) pancreatic lipase related protein 1,
human-PNLIPRP2 Homo sapiens (Human) pancreatic lipase related protein 2,
human-PNLIPRP3 Homo sapiens (Human) Pancreatic lipase-related protein 3 .
PC-sterol_acyltransferase :
human-LCAT Homo sapiens (Human) phosphatidylcholine-sterol acyltransferase,
human-PLA2G15 Homo sapiens (Human) Group XV phospholipase A2 lcat-like lysophospholipase (llpl) (unq341/pro540).
Pectinacetylesterase-Notum :
human-NOTUM Homo sapiens (Human) Protein notum homolog.
PGAP1 :
human-PGAP1 Homo sapiens (Human)GPI inositol-deacylase PGAP1 117.8 kd protein in ste2-frs2 intergenic region ,
human-SERAC1 Homo sapiens (Human) Protein SERAC1 .
Phospholipase :
human-LIPH Homo sapiens (Human) membrane-bound phosphatidic acid-selective phospholipase a1-alpha, LPD lipase-related protein mPA-PLA1 alpha ,
human-LIPI Homo sapiens (Human) membrane-associated phosphatidic acid-selective phospholipase a1 beta mPA-PLA1 beta (LPD lipase) Cancer/testis antigen 17 CT17 ,
human-PLA1A Homo sapiens (Human) Phospholipase A1 member A, phosphatidylserine-specific phospholipase A1 deltaC .
PPase_methylesterase_euk :
human-PPME1 Homo sapiens (Human) protein phosphatase PP2A methylesterase-1 (EC 3.1.1.-) (pme-1).
Prolylcarboxypeptidase :
human-DPP7 Homo sapiens (Human), Dipeptidyl peptidase 2, quiescent cell proline dipeptidase precursor, DPP7, DPP2, QPP,
human-PRCP Homo sapiens (Human) Lysosomal Pro-X carboxypeptidase C prolylcarboxypeptidase , Angiotensinase C, Proline carboxypeptidase (EC3.4.16.2),
human-PRSS16 Homo sapiens (Human) PRSS16 protease, serine, 16 (thymus) TSSP thymus-specific serine protease precursor (EC 3.4.-.-) .
S9N_PPCE_Peptidase_S9 :
human-PREP Homo sapiens (Human) Prolyl endopeptidase PE, Post-proline cleaving enzyme PPCE, prolyl oligopeptidase POP.
S9N_PREPL_Peptidase_S9 :
human-PREPL Homo sapiens (Human) PREPL Prolylendopeptidase-like KIAA0436 .
SERHL :
human-SERHL2 Homo sapiens (Human) serine hydrolase-like protein 2 SERHL2 chomosome 22 .
Thioesterase :
human-FASN Homo sapiens (Human) FAS FASN Fatty acid synthase Thioesterase domain (EC 2.3.1.85),
human-OLAH Homo sapiens (Human) s-acyl fatty acid synthase thioesterase, medium chain OLAH THEDC1 SAST (EC 3.1.2.14).
Thyroglobulin :
human-TG Homo sapiens (Human) Thyroglobulin TG Tg.
Valacyclovir-hydrolase :
human-BPHL Homo sapiens (Human) biphenyl hydrolase-like DJ40E16.6.3, breast epithelial mucin-associated antigen AG BPHL (mcnaa), Valacyclovir hydrolase VACVaseMolecular evidence
Database
No mutation No structure No kinetic
> 3 Genbank links 8 more : AF106704 , AX083419 , AF282617 < 11 Genbank links 8 less : AF106704 , AX083419 , AF282617 , AC005162 , AF217508 , AK075433 , AY358549 , AC007096 , AC004593 , AC005232 , AK124472 3 Ncbi-nid :
11559511 ,
10180963 ,
13185256 > 3 Ncbi-pid links 2 more : 11559512 , 12060148 , 12060147 < 5 Ncbi-pid links 2 less : 11559512 , 12060148 , 12060147 , 10180964 , 13185257 > 3 UniProtTrembl links 6 more : Q9H3G5 , O75225 , Q9NZ90 < 9 UniProtTrembl links 6 less : Q9H3G5 , O75225 , Q9NZ90 , Q75MM4 , C9JI22 , B3KW79 , C9JLV0 , C9J6L4 , H7C218 > 3 Interpro links 6 more : Q9H3G5 , O75225 , Q9NZ90 < 9 Interpro links 6 less : Q9H3G5 , O75225 , Q9NZ90 , Q75MM4 , C9JI22 , B3KW79 , C9JLV0 , C9J6L4 , H7C218 > 3 Prodom links 6 more : Q9H3G5 , O75225 , Q9NZ90 < 9 Prodom links 6 less : Q9H3G5 , O75225 , Q9NZ90 , Q75MM4 , C9JI22 , B3KW79 , C9JLV0 , C9J6L4 , H7C218 > 3 Pfam links 6 more : Q9H3G5 , O75225 , Q9NZ90 < 9 Pfam links 6 less : Q9H3G5 , O75225 , Q9NZ90 , Q75MM4 , C9JI22 , B3KW79 , C9JLV0 , C9J6L4 , H7C218 > 3 PIRSF links 6 more : Q9H3G5 , O75225 , Q9NZ90 < 9 PIRSF links 6 less : Q9H3G5 , O75225 , Q9NZ90 , Q75MM4 , C9JI22 , B3KW79 , C9JLV0 , C9J6L4 , H7C218 > 3 SUPERFAM links 6 more : Q9H3G5 , O75225 , Q9NZ90 < 9 SUPERFAM links 6 less : Q9H3G5 , O75225 , Q9NZ90 , Q75MM4 , C9JI22 , B3KW79 , C9JLV0 , C9J6L4 , H7C218 > 3 QuickSwissBlast links 6 more : Q9H3G5 , O75225 , Q9NZ90 < 9 QuickSwissBlast links 6 less : Q9H3G5 , O75225 , Q9NZ90 , Q75MM4 , C9JI22 , B3KW79 , C9JLV0 , C9J6L4 , H7C218 1 EntrezGene :
54504 1 SNP :
54504 1 UniGene :
233389 1 HUGO HGNC :
14399 1 IUPHAR :
1583 1 OMIM :
609780 1 Ensembl :
ENSG00000106066
Sequence
Graphical view for this peptide sequence: human-CPVL Colored MSA for Carboxypeptidase_S10 (raw)
MVGAMWKVIVSLVLLMPGPCDGLFRSLYRSVSMPPKGDSGQPLFLTPYIE
AGKIQKGRELSLVGPFPGLNMKSYAGFLTVNKTNNSNLFFWFFPAQIQPE
DAPVVLWLQGGPGGSSMFGLFVEHGPYVVTSNMTLRDRDFPWTTTLSMLY
IDNPVGTGFSFTDDTHGYAVNEDDVARDLYSALIQFFQIFPEYKNNDFYV
TGESYAGKYVPAIAHLIHSLNPVREVKINLNGIAIGDGYSDPESIIGGYA
EFLYQIGLLDEKQKKYFQKQCHECIEHIRKQNWLEAFEILDKLLEGDLTS
DPSYFQNVTGCSNYYNFLRCTEPEDQLYYVKFLSLPEVRQAIHVGNQTFN
DGTIVEKYLREDTVQSVKPWLTEIMNNYKVLIYNGQLDIIVAAALTEHSL
MGMDWKGSQEYKKAEKKVWKIFKSDSEVAGYIRQAGDFHQVIIRGGGHIL
PYDQPLRAFDMINRFIYGKGWDPYVG
Legend
This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA
M V G A M W K V I V S L V L L M P G P C D G L F R S L Y R S V S M P P K G D S G Q P L F L T P Y I E A G K I Q K G R E L S L V G P F P G L N M K S Y A G F L T V N K T N N S N L F F W F F P A Q I Q P E D A P V V L W L Q G G P G G S S M F G L F V E H G P Y V V T S N M T L R D R D F P W T T T L S M L Y I D N P V G T G F S F T D D T H G Y A V N E D D V A R D L Y S A L I Q F F Q I F P E Y K N N D F Y V T G E S Y A G K Y V P A I A H L I H S L N P V R E V K I N L N G I A I G D G Y S D P E S I I G G Y A E F L Y Q I G L L D E K Q K K Y F Q K Q C H E C I E H I R K Q N W L E A F E I L D K L L E G D L T S D P S Y F Q N V T G C S N Y Y N F L R C T E P E D Q L Y Y V K F L S L P E V R Q A I H V G N Q T F N D G T I V E K Y L R E D T V Q S V K P W L T E I M N N Y K V L I Y N G Q L D I I V A A A L T E H S L M G M D W K G S Q E Y K K A E K K V W K I F K S D S E V A G Y I R Q A G D F H Q V I I R G G G H I L P Y D Q P L R A F D M I N R F I Y G K G W D P Y V G Graphical view for this nucleotide DNA sequence (1650 bp): human-CPVL
References
Title: Complete sequencing and characterization of 21,243 full-length human cDNAs
Ota T , Suzuki Y , Nishikawa T , Otsuki T , Sugiyama T , Irie R , Wakamatsu A , Hayashi K , Sato H and Sugano S <144 more author(s)>
Ota T , Suzuki Y , Nishikawa T , Otsuki T , Sugiyama T , Irie R , Wakamatsu A , Hayashi K , Sato H , Nagai K , Kimura K , Makita H , Sekine M , Obayashi M , Nishi T , Shibahara T , Tanaka T , Ishii S , Yamamoto J , Saito K , Kawai Y , Isono Y , Nakamura Y , Nagahari K , Murakami K , Yasuda T , Iwayanagi T , Wagatsuma M , Shiratori A , Sudo H , Hosoiri T , Kaku Y , Kodaira H , Kondo H , Sugawara M , Takahashi M , Kanda K , Yokoi T , Furuya T , Kikkawa E , Omura Y , Abe K , Kamihara K , Katsuta N , Sato K , Tanikawa M , Yamazaki M , Ninomiya K , Ishibashi T , Yamashita H , Murakawa K , Fujimori K , Tanai H , Kimata M , Watanabe M , Hiraoka S , Chiba Y , Ishida S , Ono Y , Takiguchi S , Watanabe S , Yosida M , Hotuta T , Kusano J , Kanehori K , Takahashi-Fujii A , Hara H , Tanase TO , Nomura Y , Togiya S , Komai F , Hara R , Takeuchi K , Arita M , Imose N , Musashino K , Yuuki H , Oshima A , Sasaki N , Aotsuka S , Yoshikawa Y , Matsunawa H , Ichihara T , Shiohata N , Sano S , Moriya S , Momiyama H , Satoh N , Takami S , Terashima Y , Suzuki O , Nakagawa S , Senoh A , Mizoguchi H , Goto Y , Shimizu F , Wakebe H , Hishigaki H , Watanabe T , Sugiyama A , Takemoto M , Kawakami B , Watanabe K , Kumagai A , Itakura S , Fukuzumi Y , Fujimori Y , Komiyama M , Tashiro H , Tanigami A , Fujiwara T , Ono T , Yamada K , Fujii Y , Ozaki K , Hirao M , Ohmori Y , Kawabata A , Hikiji T , Kobatake N , Inagaki H , Ikema Y , Okamoto S , Okitani R , Kawakami T , Noguchi S , Itoh T , Shigeta K , Senba T , Matsumura K , Nakajima Y , Mizuno T , Morinaga M , Sasaki M , Togashi T , Oyama M , Hata H , Komatsu T , Mizushima-Sugano J , Satoh T , Shirai Y , Takahashi Y , Nakagawa K , Okumura K , Nagase T , Nomura N , Kikuchi H , Masuho Y , Yamashita R , Nakai K , Yada T , Ohara O , Isogai T , Sugano S (- 144)
Ref: Nat Genet, 36 :40, 2004 : PubMed Abstract ESTHER: Ota_2004_Nat.Genet_36_40 PubMedSearch: Ota 2004 Nat.Genet 36 40 PubMedID: 14702039 Gene_locus related to this paper: human-ABHD1 ,
human-ABHD4 ,
human-ABHD12 ,
human-ABHD16A ,
human-ACOT1 ,
human-LDAH ,
human-ABHD18 ,
human-CES1 ,
human-CES4A ,
human-CES5A ,
human-CPVL ,
human-DAGLB ,
human-EPHX2 ,
human-KANSL3 ,
human-LIPA ,
human-LPL ,
human-MEST ,
human-NDRG1 ,
human-NLGN1 ,
human-NLGN4X ,
human-PRCP ,
human-PRSS16 ,
human-SERAC1 ,
human-TMEM53 Abstract
As a base for human transcriptome and functional genomics, we created the "full-length long Japan" (FLJ) collection of sequenced human cDNAs. We determined the entire sequence of 21,243 selected clones and found that 14,490 cDNAs (10,897 clusters) were unique to the FLJ collection. About half of them (5,416) seemed to be protein-coding. Of those, 1,999 clusters had not been predicted by computational methods. The distribution of GC content of nonpredicted cDNAs had a peak at approximately 58% compared with a peak at approximately 42%for predicted cDNAs. Thus, there seems to be a slight bias against GC-rich transcripts in current gene prediction procedures. The rest of the cDNAs unique to the FLJ collection (5,481) contained no obvious open reading frames (ORFs) and thus are candidate noncoding RNAs. About one-fourth of them (1,378) showed a clear pattern of splicing. The distribution of GC content of noncoding cDNAs was narrow and had a peak at approximately 42%, relatively low compared with that of protein-coding cDNAs.
         Title: The DNA sequence of human chromosome 7
Hillier LW , Fulton RS , Fulton LA , Graves TA , Pepin KH , Wagner-McPherson C , Layman D , Maas J , Jaeger S and Wilson RK <97 more author(s)>
Hillier LW , Fulton RS , Fulton LA , Graves TA , Pepin KH , Wagner-McPherson C , Layman D , Maas J , Jaeger S , Walker R , Wylie K , Sekhon M , Becker MC , O'Laughlin MD , Schaller ME , Fewell GA , Delehaunty KD , Miner TL , Nash WE , Cordes M , Du H , Sun H , Edwards J , Bradshaw-Cordum H , Ali J , Andrews S , Isak A , Vanbrunt A , Nguyen C , Du F , Lamar B , Courtney L , Kalicki J , Ozersky P , Bielicki L , Scott K , Holmes A , Harkins R , Harris A , Strong CM , Hou S , Tomlinson C , Dauphin-Kohlberg S , Kozlowicz-Reilly A , Leonard S , Rohlfing T , Rock SM , Tin-Wollam AM , Abbott A , Minx P , Maupin R , Strowmatt C , Latreille P , Miller N , Johnson D , Murray J , Woessner JP , Wendl MC , Yang SP , Schultz BR , Wallis JW , Spieth J , Bieri TA , Nelson JO , Berkowicz N , Wohldmann PE , Cook LL , Hickenbotham MT , Eldred J , Williams D , Bedell JA , Mardis ER , Clifton SW , Chissoe SL , Marra MA , Raymond C , Haugen E , Gillett W , Zhou Y , James R , Phelps K , Iadanoto S , Bubb K , Simms E , Levy R , Clendenning J , Kaul R , Kent WJ , Furey TS , Baertsch RA , Brent MR , Keibler E , Flicek P , Bork P , Suyama M , Bailey JA , Portnoy ME , Torrents D , Chinwalla AT , Gish WR , Eddy SR , McPherson JD , Olson MV , Eichler EE , Green ED , Waterston RH , Wilson RK (- 97)
Ref: Nature, 424 :157, 2003 : PubMed Abstract ESTHER: Hillier_2003_Nature_424_157 PubMedSearch: Hillier 2003 Nature 424 157 PubMedID: 12853948 Gene_locus related to this paper: human-ABHD11 ,
human-ACHE ,
human-CPVL ,
human-DPP6 ,
human-MEST Abstract
Human chromosome 7 has historically received prominent attention in the human genetics community, primarily related to the search for the cystic fibrosis gene and the frequent cytogenetic changes associated with various forms of cancer. Here we present more than 153 million base pairs representing 99.4% of the euchromatic sequence of chromosome 7, the first metacentric chromosome completed so far. The sequence has excellent concordance with previously established physical and genetic maps, and it exhibits an unusual amount of segmentally duplicated sequence (8.2%), with marked differences between the two arms. Our initial analyses have identified 1,150 protein-coding genes, 605 of which have been confirmed by complementary DNA sequences, and an additional 941 pseudogenes. Of genes confirmed by transcript sequences, some are polymorphic for mutations that disrupt the reading frame.
         Title: Cloning and characterization of CPVL, a novel serine carboxypeptidase, from human macrophages
Mahoney JA , Ntolosi B , DaSilva RP , Gordon S , McKnight AJ
Ref: Genomics, 72 :243, 2001 : PubMed Abstract ESTHER: Mahoney_2001_Genomics_72_243 PubMedSearch: Mahoney 2001 Genomics 72 243 PubMedID: 11401439 Gene_locus related to this paper: human-CPVL Abstract
Carboxypeptidases are proteases that cleave single amino acids from the carboxy termini of proteins or peptides. In addition to degradative functions in the gut, carboxypeptidases activate or inactivate bioactive peptides such as angiotensin, bradykinin, and endothelin I. Using differential display PCR, we cloned a novel carboxypeptidase expressed in human macrophages but not in other leukocytes. The 476-amino-acid gene product has a putative signal sequence but no transmembrane domain and has striking sequence similarity to serine carboxypeptidases, a large family of enzymes in eukaryotes. Only one serine carboxypeptidase, lysosomal protective protein, has previously been reported in mammals. Among known proteins, this gene is most similar (43% amino acid identity) to vitellogenic carboxypeptidase, a serine carboxypeptidase expressed in mosquito ovaries. Therefore, we have named this new gene carboxypeptidase, vitellogenic-like (CPVL). In addition to monocyte/macrophage-rich sources such as spleen, leukocytes, and placenta, CPVL mRNA is abundantly expressed in heart and kidney, suggesting a separate role for CPVL outside the immune system. The CPVL gene contains at least 13 exons spread over more than 150 kb on human chromosome 7p14-p15. An affinity-purified polyclonal antiserum recognized a protein of approximately 57 kDa in macrophage lysates, but not in lysates from lymphocytes, neutrophils, or monocytes. CPVL protein expression was induced during maturation of monocytes into macrophages. Possible functions for CPVL in macrophages include digestion of phagocytosed particles in the lysosome, participation in an inflammatory protease cascade, and trimming of peptides for antigen presentation.
         Other Papers