Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: human-DPP7

Homo sapiens (Human), Dipeptidyl peptidase 2, quiescent cell proline dipeptidase precursor, DPP7, DPP2, QPP

Relationship
Family|Prolylcarboxypeptidase
Block| X
Position in NCBI Life Tree|Homo sapiens
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Primates: N E > Haplorrhini: N E > Simiiformes: N E > Catarrhini: N E > Hominoidea: N E > Hominidae: N E > Homininae: N E > Homo: N E > Homo sapiens: N E


Molecular evidence
Database
No mutation
3 structures: 3JYH, 3N0T, 4EBB
No kinetic





No Substrate
2 inhibitors: GSK237826A, UAMC00039
>3 Genbank links 3 more: AF154502, AB209787, BC011907
3 UniProt : Q9UHL4, Q59EM4, B4DPD6
3 Structure : 4EBB, 3N0T, 3JYH
3 UniProt : Q59EM4, Q9UHL4, B4DPD6
3 Interpro : Q59EM4, Q9UHL4, B4DPD6
3 Prodom : Q59EM4, Q9UHL4, B4DPD6
3 Pfam : Q59EM4, Q9UHL4, B4DPD6
3 PIRSF : Q59EM4, Q9UHL4, B4DPD6
3 SUPERFAM : Q59EM4, Q9UHL4, B4DPD6
1 EntrezGene : 29952
1 SNP : 29952
1 UniGene : 37916
1 HUGO HGNC : 14892
1 IUPHAR : 1605
1 OMIM : 610537
1 Ensembl : ENSG00000176978
Sequence
Graphical view for this peptide sequence: human-DPP7
Colored MSA for Prolylcarboxypeptidase (raw)
MGSAPWAPVLLLALGLRGLQAGARRAPDPGFQERFFQQRLDHFNFERFGN
KTFPQRFLVSDRFWVRGEGPTFFYTGNEGDVWAFANNSGFVAELAAERGA
LLVFAEHRYYGKSLPFGAQSTQRGHTELLTVEQALADFAELLRALRRDLG
AQDAPAIAFGGSYGGMLSAYLRMKYPHLVAGALAASAPVLAVAGLGDSNQ
FFRDVTADFEGQSPKCTQGVREAFRQIKDLFLQGAYDTVRWEFGTCQPLS
DEKDLTQLFMFARNAFTVLAMMDYPYPTDFLGPLPANPVKVGCDRLLSEA
QRITGLRALAGLVYNASGSEHCYDIYRLYHSCADPTGCGTGPDARAWDYQ
ACTEINLTFASNNVTDMFPDLPFTDELRQRYCLDTWGVWPRPDWLLTSFW
GGDLRAASNIIFSNGNLDPWAGGGIRRNLSASVIAVTIQGGAHHLDLRAS
HPEDPASVVEARKLEATIIGEWVKAARREQQPALRGGPRLSL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGSAPWAPVLLLALGLRGLQAGARRAPDPGFQERFFQQRLDHFNFERFGN
KTFPQRFLVSDRFWVRGEGPTFFYTGNEGDVWAFANNSGFVAELAAERGA
LLVFAEHRYYGKSLPFGAQSTQRGHTELLTVEQALADFAELLRALRRDLG
AQDAPAIAFGGSYGGMLSAYLRMKYPHLVAGALAASAPVLAVAGLGDSNQ
FFRDVTADFEGQSPKCTQGVREAFRQIKDLFLQGAYDTVRWEFGTCQPLS
DEKDLTQLFMFARNAFTVLAMMDYPYPTDFLGPLPANPVKVGCDRLLSEA
QRITGLRALAGLVYNASGSEHCYDIYRLYHSCADPTGCGTGPDARAWDYQ
ACTEINLTFASNNVTDMFPDLPFTDELRQRYCLDTWGVWPRPDWLLTSFW
GGDLRAASNIIFSNGNLDPWAGGGIRRNLSASVIAVTIQGGAHHLDLRAS
HPEDPASVVEARKLEATIIGEWVKAARREQQPALRGGPRLSL


References
1 more
    Title: Kinetic investigation of human dipeptidyl peptidase II (DPPII)-mediated hydrolysis of dipeptide derivatives and its identification as quiescent cell proline dipeptidase (QPP)/dipeptidyl peptidase 7 (DPP7)
    Maes MB, Lambeir AM, Gilany K, Senten K, Van der Veken P, Leiting B, Augustyns K, Scharpe S, De Meester I
    Ref: Biochemical Journal, 386:315, 2005 : PubMed

            

    Title: Vesicular localization and characterization of a novel post-proline-cleaving aminodipeptidase, quiescent cell proline dipeptidase.
    Chiravuri M, Agarraberes F, Mathieu SL, Lee H, Huber BT
    Ref: J Immunol, 165:5695, 2000 : PubMed

            

    Title: Sequence, purification, and cloning of an intracellular serine protease, quiescent cell proline dipeptidase
    Underwood R, Chiravuri M, Lee H, Schmitz T, Kabcenell AK, Yardley K, Huber BT
    Ref: Journal of Biological Chemistry, 274:34053, 1999 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer