Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: human-DPP9

Homo sapiens (Human) dipeptidyl peptidase 9 DPP9 DPRP2

Comment
DPP8 and DPP9 are cytosolic peptidases. Have dpp activity similar to dpp4. The first identified endogenous DPP9 substrate is the tumor epitope RU13442 (VPYGSFKHV). Inhibition or silencing of DPP9, but not DPP8, led to increased presentation of this antigen on MHC class I alleles to cytotoxic T-cells, linking DPP9 to the MHC class I antigen presentation pathway. Small ubiquitin-like protein modifier SUMO1 acts as an allosteric activator of DPP9. By binding to an armlike motif in DPP9; DPP9 functions as an endogenous inhibitor of NLRP1 inflammasome. DPP9 interacts with a unique autoproteolytic domain (Function to Find Domain (FIIND)) found in NLRP1 and CARD8


Relationship
Family|DPP4N_Peptidase_S9
Block| X
Position in NCBI Life Tree|Homo sapiens
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Primates: N E > Haplorrhini: N E > Simiiformes: N E > Catarrhini: N E > Hominoidea: N E > Hominidae: N E > Homininae: N E > Homo: N E > Homo sapiens: N E


Molecular evidence
Database
4 mutations: Table (e.g. : G167S_human-DPP9, Q851X_human-DPP9, R111X_human-DPP9 ... more)
11 structures (e.g. : 6EOQ, 6EOR, 6QZV... more)
No kinetic

Disease: Hatipoglu syndrome -



1 substrate:
VPYGSFKHV
6 inhibitors (e.g. : 1G244, ICeD-1, ICeD-2... more)
>3 Genbank links 8 more: AK131499, CR627380, AF542510
1 UniProt : Q86TI2
>3 Structure links 8 more: 7ZXS, 7SVN, 7SVL
1 UniProt : Q86TI2
1 Interpro : Q86TI2
1 Prodom : Q86TI2
1 Pfam : Q86TI2
1 PIRSF : Q86TI2
1 SUPERFAM : Q86TI2
1 EntrezGene : 91039
1 SNP : 91039
1 UniGene : 515081
1 HUGO HGNC : 18648
1 IUPHAR : 2357
1 OMIM : 608258
1 Ensembl : ENSG00000142002
Sequence
Graphical view for this peptide sequence: human-DPP9
Colored MSA for DPP4N_Peptidase_S9 (raw)
RRVPCVRRGCRPPLPPLPGSQSRAWSRDREAPLDPGRPAQSGRRPTSRSV
SHACSWNGGSLDPLEGTPALLRSAERLMRKVKKLRLDKENTGSWRSFSLN
SEGAERMATTGTPTADRGDAAATDDPAARFQVQKHSWDGLRSIIHGSRKY
SGLIVNKAPHDFQFVQKTDESGPHSHRLYYLGMPYGSRENSLLYSEIPKK
VRKEALLLLSWKQMLDHFQATPHHGVYSREEELLRERKRLGVFGITSYDF
HSESGLFLFQASNSLFHCRDGGKNGFMVSPMKPLEIKTQCSGPRMDPKIC
PADPAFFSFNNNSDLWVANIETGEERRLTFCHQGLSNVLDDPKSAGVATF
VIQEEFDRFTGYWWCPTASWEGSEGLKTLRILYEEVDESEVEVIHVPSPA
LEERKTDSYRYPRTGSKNPKIALKLAEFQTDSQGKIVSTQEKELVQPFSS
LFPKVEYIARAGWTRDGKYAWAMFLDRPQQWLQLVLLPPALFIPSTENEE
QRLASARAVPRNVQPYVVYEEVTNVWINVHDIFYPFPQSEGEDELCFLRA
NECKTGFCHLYKVTAVLKSQGYDWSEPFSPGEDEFKCPIKEEIALTSGEW
EVLARHGSKIWVNEETKLVYFQGTKDTPLEHHLYVVSYEAAGEIVRLTTP
GFSHSCSMSQNFDMFVSHYSSVSTPPCVHVYKLSGPDDDPLHKQPRFWAS
MMEAASCPPDYVPPEIFHFHTRSDVRLYGMIYKPHALQPGKKHPTVLFVY
GGPQVQLVNNSFKGIKYLRLNTLASLGYAVVVIDGRGSCQRGLRFEGALK
NQMGQVEIEDQVEGLQFVAEKYGFIDLSRVAIHGWSYGGFLSLMGLIHKP
QVFKVAIAGAPVTVWMAYDTGYTERYMDVPENNQHGYEAGSVALHVEKLP
NEPNRLLILHGFLDENVHFFHTNFLVSQLIRAGKPYQLQIYPNERHSIRC
PESGEHYEVTLLHFLQEYL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

RRVPCVRRGCRPPLPPLPGSQSRAWSRDREAPLDPGRPAQSGRRPTSRSV
SHACSWNGGSLDPLEGTPALLRSAERLMRKVKKLRLDKENTGSWRSFSLN
SEGAERMATTGTPTADRGDAAATDDPAARFQVQKHSWDGLRSIIHGSRKY
SGLIVNKAPHDFQFVQKTDESGPHSHRLYYLGMPYGSRENSLLYSEIPKK
VRKEALLLLSWKQMLDHFQATPHHGVYSREEELLRERKRLGVFGITSYDF
HSESGLFLFQASNSLFHCRDGGKNGFMVSPMKPLEIKTQCSGPRMDPKIC
PADPAFFSFNNNSDLWVANIETGEERRLTFCHQGLSNVLDDPKSAGVATF
VIQEEFDRFTGYWWCPTASWEGSEGLKTLRILYEEVDESEVEVIHVPSPA
LEERKTDSYRYPRTGSKNPKIALKLAEFQTDSQGKIVSTQEKELVQPFSS
LFPKVEYIARAGWTRDGKYAWAMFLDRPQQWLQLVLLPPALFIPSTENEE
QRLASARAVPRNVQPYVVYEEVTNVWINVHDIFYPFPQSEGEDELCFLRA
NECKTGFCHLYKVTAVLKSQGYDWSEPFSPGEDEFKCPIKEEIALTSGEW
EVLARHGSKIWVNEETKLVYFQGTKDTPLEHHLYVVSYEAAGEIVRLTTP
GFSHSCSMSQNFDMFVSHYSSVSTPPCVHVYKLSGPDDDPLHKQPRFWAS
MMEAASCPPDYVPPEIFHFHTRSDVRLYGMIYKPHALQPGKKHPTVLFVY
GGPQVQLVNNSFKGIKYLRLNTLASLGYAVVVIDGRGSCQRGLRFEGALK
NQMGQVEIEDQVEGLQFVAEKYGFIDLSRVAIHGWSYGGFLSLMGLIHKP
QVFKVAIAGAPVTVWMAYDTGYTERYMDVPENNQHGYEAGSVALHVEKLP
NEPNRLLILHGFLDENVHFFHTNFLVSQLIRAGKPYQLQIYPNERHSIRC
PESGEHYEVTLLHFLQEYL


References
36 more
    Title: Dipeptidyl peptidase 9 triggers BRCA2 degradation and promotes DNA damage repair
    Bolgi O, Silva-Garcia M, Ross B, Pilla E, Kari V, Killisch M, Spitzner M, Stark N, Lenz C and Geiss-Friedlander R <8 more author(s)>
    Ref: EMBO Rep, :e54136, 2022 : PubMed

            

    Title: Dipeptidyl peptidase 9 sets a threshold for CARD8 inflammasome formation by sequestering its active C-terminal fragment
    Sharif H, Hollingsworth LR, Griswold AR, Hsiao JC, Wang Q, Bachovchin DA, Wu H
    Ref: Immunity, :, 2021 : PubMed

            

    Title: Structural mechanism of CARD8 regulation by DPP9
    Sharif H, Hollingsworth LR, Griswold AR, Hsiao JC, Wang QH, Bachovchin DA, Wu H
    Ref: Biorxiv, :, 2021 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer