human-LDAH

 
Homo sapiens (Human) lipid droplet-associated hydrolase (LDAH) C2orf43

Relationship
Block X
Homo sapiens position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Primates: N E > Haplorrhini: N E > Simiiformes: N E > Catarrhini: N E > Hominoidea: N E > Hominidae: N E > Homininae: N E > Homo: N E > Homo sapiens: N E

Molecular evidence
Database
No mutation
No structure
No kinetic



>3 Genbank links 9 more: AK025473, AK299244, CH471053
>3 UniProt links 8 more: B4DRG3, B5MDU6, Q9H6V9
>3 UniProtTrembl links 8 more: B4DRG3, Q9H6V9, B5MDU6
>3 Interpro links 8 more: B4DRG3, Q9H6V9, B5MDU6
>3 Prodom links 8 more: B4DRG3, Q9H6V9, B5MDU6
>3 Pfam links 8 more: B4DRG3, Q9H6V9, B5MDU6
>3 PIRSF links 8 more: B4DRG3, Q9H6V9, B5MDU6
>3 SUPERFAM links 8 more: B4DRG3, Q9H6V9, B5MDU6
>3 QuickSwissBlast links 8 more: B4DRG3, Q9H6V9, B5MDU6
1 EntrezGene : 60526
1 SNP : 60526
1 UniGene : 187823
1 HUGO HGNC : 26145
1 OMIM : 613570
1 Ensembl : ENSG00000118961
 
Sequence
Graphical view for this peptide sequence: human-LDAH
Colored MSA for LIDHydrolase (raw)
MDSELKEEIPVHEEFILCGGAETQVLKCGPWTDLFHDQSVKRPKLLIFII
PGNPGFSAFYVPFAKALYSLTNRRFPVWTISHAGHALAPKDKKILTTSED
SNAQEIKDIYGLNGQIEHKLAFLRTHVPKDMKLVLIGHSIGSYFTLQMLK
RVPELPVIRAFLLFPTIERMSESPNGRIATPLLCWFRYVLYVTGYLLLKP
CPETIKSLLIRRGLQVMNLENEFSPLNILEPFCLANAAYLGGQEMMEVVK
RDDETIKEHLCKLTFYYGTIDPWCPKEYYEDIKKDFPEGDIRLCEKNIPH
AFITHFNQEMADMIADSLKDDLSKIGNPSWHYHSLRTMRCPSAQILKPPD
ERFGSDLLPTYWWKNQISRD
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MDSELKEEIPVHEEFILCGGAETQVLKCGPWTDLFHDQSVKRPKLLIFII
PGNPGFSAFYVPFAKALYSLTNRRFPVWTISHAGHALAPKDKKILTTSED
SNAQEIKDIYGLNGQIEHKLAFLRTHVPKDMKLVLIGHSIGSYFTLQMLK
RVPELPVIRAFLLFPTIERMSESPNGRIATPLLCWFRYVLYVTGYLLLKP
CPETIKSLLIRRGLQVMNLENEFSPLNILEPFCLANAAYLGGQEMMEVVK
RDDETIKEHLCKLTFYYGTIDPWCPKEYYEDIKKDFPEGDIRLCEKNIPH
AFITHFNQEMADMIADSLKDDLSKIGNPSWHYHSLRTMRCPSAQILKPPD
ERFGSDLLPTYWWKNQISRD

no DNA




References
3 more
    Title: Mice lacking lipid droplet-associated hydrolase, a gene linked to human prostate cancer, have normal cholesterol ester metabolism
    Kory N, Grond S, Kamat SS, Li Z, Krahmer N, Chitraju C, Zhou P, Frohlich F, Semova I and Walther TC <4 more author(s)>
    Ref: J Lipid Res, 58:226, 2017 : PubMed

            

    Title: Novel lipid droplet-associated serine hydrolase regulates macrophage cholesterol mobilization
    Goo YH, Son SH, Kreienberg PB, Paul A
    Ref: Arterioscler Thromb Vasc Biol, 34:386, 2014 : PubMed

            

    Title: Roles and origins of leukocyte lipid bodies: proteomic and ultrastructural studies
    Wan HC, Melo RC, Jin Z, Dvorak AM, Weller PF
    Ref: FASEB Journal, 21:167, 2007 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer