human-LIPG

 
Homo sapiens (Human) endothelial lipase LIPE_HUMAN flj43354

Comment
Endothelial lipase is a phospholipase and triglyceride lipase (predominantly phospholipase). Endothelial lipase regulates the circulating level of high density lipoprotein cholesterol (HDL-C) (the phospholipid-enriched high-density lipoprotein (HDL) is its preferred substrate). LIPG is expressed in the liver, placenta, lung, thyroid, kidney, testis and in the corpus luteum of the ovary, but is not detected in heart, brain and muscle. It can also form a molecular bridge between endothelial cells and lipoproteins or circulating macrophages through interaction with heparan sulfate proteoglycans. This nonenzymatic action can increase cellular lipoprotein uptake and monocyte adhesion and contribute to atherosclerosis


Relationship
Block L
Homo sapiens position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Primates: N E > Haplorrhini: N E > Simiiformes: N E > Catarrhini: N E > Hominoidea: N E > Hominidae: N E > Homininae: N E > Homo: N E > Homo sapiens: N E

Molecular evidence
Database
3 mutations: Table (ordered Natural and SD mutagenesis)T111I_human-LIPG, N396S_human-LIPG, G26S_human-LIPG
No structure
No kinetic

Substrate: PED6 ,
Inhibitor: SCHEMBL15589912 , LIPG-inhib-Compound8i , LIPG-inhib-Compound32 , XEN445 , GSK-264220A ,
>3 Genbank links 7 more: AY358928, BC060825, AF118767
>3 UniProt links 4 more: Q9Y5X9, A8K6Y4, B4DTR8
>3 UniProtTrembl links 4 more: Q9Y5X9, A8K6Y4, B4DTR8
>3 Interpro links 4 more: Q9Y5X9, A8K6Y4, B4DTR8
>3 Prodom links 4 more: Q9Y5X9, A8K6Y4, B4DTR8
>3 Pfam links 4 more: Q9Y5X9, A8K6Y4, B4DTR8
>3 PIRSF links 4 more: Q9Y5X9, A8K6Y4, B4DTR8
>3 SUPERFAM links 4 more: Q9Y5X9, A8K6Y4, B4DTR8
>3 QuickSwissBlast links 4 more: Q9Y5X9, A8K6Y4, B4DTR8
1 EntrezGene : 9388
1 SNP : 9388
1 UniGene : 465102
1 HUGO HGNC : 6623
1 IUPHAR : 2591
1 OMIM : 603684
1 Ensembl : ENSG00000101670
 
Sequence
Graphical view for this peptide sequence: human-LIPG
Colored MSA for Lipoprotein_Lipase (raw)
MSNSVPLLCFWSLCYCFAAGSPVPFGPEGRLEDKLHKPKATQTEVKPSVR
FNLRTSKDPEHEGCYLSVGHSQPLEDCSFNMTAKTFFIIHGWTMSGIFEN
WLHKLVSALHTREKDANVVVVDWLPLAHQLYTDAVNNTRVVGHSIARMLD
WLQEKDDFSLGNVHLIGYSLGAHVAGYAGNFVKGTVGRITGLDPAGPMFE
GADIHKRLSPDDADFVDVLHTYTRSFGLSIGIQMPVGHIDIYPNGGDFQP
GCGLNDVLGSIAYGTITEVVKCEHERAVHLFVDSLVNQDKPSFAFQCTDS
NRFKKGICLSCRKNRCNSIGYNAKKMRNKRNSKMYLKTRAGMPFRVYHYQ
MKIHVFSYKNMGEIEPTFYVTLYGTNADSQTLPLEIVERIEQNATNTFLV
YTEEDLGDLLKIQLTWEGASQSWYNLWKEFRSYLSQPRNPGRELNIRRIR
VKSGETQRKLTFCTEDPENTSISPGRELWFRKCRDGWRMKNETSPTVELP
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSNSVPLLCFWSLCYCFAAGSPVPFGPEGRLEDKLHKPKATQTEVKPSVR
FNLRTSKDPEHEGCYLSVGHSQPLEDCSFNMTAKTFFIIHGWTMSGIFEN
WLHKLVSALHTREKDANVVVVDWLPLAHQLYTDAVNNTRVVGHSIARMLD
WLQEKDDFSLGNVHLIGYSLGAHVAGYAGNFVKGTVGRITGLDPAGPMFE
GADIHKRLSPDDADFVDVLHTYTRSFGLSIGIQMPVGHIDIYPNGGDFQP
GCGLNDVLGSIAYGTITEVVKCEHERAVHLFVDSLVNQDKPSFAFQCTDS
NRFKKGICLSCRKNRCNSIGYNAKKMRNKRNSKMYLKTRAGMPFRVYHYQ
MKIHVFSYKNMGEIEPTFYVTLYGTNADSQTLPLEIVERIEQNATNTFLV
YTEEDLGDLLKIQLTWEGASQSWYNLWKEFRSYLSQPRNPGRELNIRRIR
VKSGETQRKLTFCTEDPENTSISPGRELWFRKCRDGWRMKNETSPTVELP

no DNA




References
43 more
    Title: Sphingosine-1-phosphate: metabolism, transport, atheroprotection and effect of statin treatment
    Therond P, Chapman MJ
    Ref: Curr Opin Lipidol, 33:199, 2022 : PubMed

            

    Title: LIPG endothelial lipase and breast cancer risk by subtypes
    Gago-Dominguez M, Redondo CM, Calaza M, Matabuena M, Bermudez MA, Perez-Fernandez R, Torres-Espanol M, Carracedo A, Castelao JE
    Ref: Sci Rep, 11:10436, 2021 : PubMed

            

    Title: LIPG SNPs, their haplotypes and gene-environment interactions on serum lipid levels
    Yang S, Yin RX, Miao L, Zhou YG, Wu J, Zhang QH
    Ref: Lipids Health Dis, 18:10, 2019 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer