Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: human-LYPLA1

Homo sapiens (Human) lysophospholipase I (LYPLA1) APT1, acyl-protein thioesterase 1 S-depalmitoylase

Comment
Previously characterized as lysophospholipase I, but has several hudred-fold higher activity as a protein thioesterase. Acyl protein thioesterase apt1, which catalyzes depalmitoylation of Galpha proteins and Ras. S-depalmitoylase found both in cytoplasm and mitochondria . A shorter form exists as a splice variant AF077199 nuc 4679011 pep 4679012 . Q9UQF9 probable isoform of same gene


Relationship
Family|LYsophospholipase_carboxylesterase
Block| X
Position in NCBI Life Tree|Homo sapiens
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Primates: N E > Haplorrhini: N E > Simiiformes: N E > Catarrhini: N E > Hominoidea: N E > Hominidae: N E > Homininae: N E > Homo: N E > Homo sapiens: N E


Molecular evidence
Database
No mutation
6 structures (e.g. : 1FJ2, 5SYM, 6QGN... more)
No kinetic





3 substrates: Depalmitoylation-probe-2, Depalmitoylation-probe-5, Esmolol
10 inhibitors (e.g. : 2-Bromopalmitate, CHEMBL3133032, CID155803778... more)
>3 Genbank links 6 more: NM_006330, AF081281, AF077198
3 UniProt : Q6IAQ1, O75608, B4DP64
2 Ncbi-nid : 4679011, 5453721
2 Ncbi-pid : 4679012, 5453722
>3 Structure links 3 more: 6QGQ, 6QGO, 6QGN
3 UniProt : O75608, Q6IAQ1, B4DP64
3 Interpro : O75608, Q6IAQ1, B4DP64
3 Prodom : O75608, Q6IAQ1, B4DP64
3 Pfam : O75608, Q6IAQ1, B4DP64
3 PIRSF : O75608, Q6IAQ1, B4DP64
3 SUPERFAM : O75608, Q6IAQ1, B4DP64
1 EntrezGene : 10434
1 SNP : 10434
1 UniGene : 744046
1 HUGO HGNC : 6737
1 OMIM : 605599
1 Ensembl : ENSG00000120992
Sequence
Graphical view for this peptide sequence: human-LYPLA1
Colored MSA for LYsophospholipase_carboxylesterase (raw)
MCGNNMSTPLPAIVPAARKATAAVIFLHGLGDTGHGWAEAFAGIRSSHIK
YICPHAPVRPVTLNMNVAMPSWFDIIGLSPDSQEDESGIKQAAENIKALI
DQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRA
SFPQGPIGGANRDISILQCHGDCDPLVPLMFGSLTVEKLKTLVNPANVTF
KTYEGMMHSSCQQEMMDVKQFIDKLLPPID
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MCGNNMSTPLPAIVPAARKATAAVIFLHGLGDTGHGWAEAFAGIRSSHIK
YICPHAPVRPVTLNMNVAMPSWFDIIGLSPDSQEDESGIKQAAENIKALI
DQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRA
SFPQGPIGGANRDISILQCHGDCDPLVPLMFGSLTVEKLKTLVNPANVTF
KTYEGMMHSSCQQEMMDVKQFIDKLLPPID


References
7 more
    Title: Palmitoylated acyl protein thioesterase APT2 deforms membranes to extract substrate acyl chains
    Abrami L, Audagnotto M, Ho S, Marcaida MJ, Mesquita FS, Anwar MU, Sandoz PA, Fonti G, Pojer F and van der Goot FG <1 more author(s)>
    Ref: Nat Chemical Biology, 17:438, 2021 : PubMed

            

    Title: Active and dynamic mitochondrial S-depalmitoylation revealed by targeted fluorescent probes
    Kathayat RS, Cao Y, Elvira PD, Sandoz PA, Zaballa ME, Springer MZ, Drake LE, Macleod KF, van der Goot FG, Dickinson BC
    Ref: Nat Commun, 9:334, 2018 : PubMed

            

    Title: Crystal structure of the human acyl protein thioesterase I from a single X-ray data set to 1.5 A
    Devedjiev Y, Dauter Z, Kuznetsov SR, Jones TL, Derewenda ZS
    Ref: Structure, 8:1137, 2000 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer