Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: human-LYPLA2

Homo sapiens (Human) acyl-protein thioesterase dJ886K2.4 lysophospholipase II APT2

Comment
another gene human-apthio2 DJ570F3.6 OldTrembl Q9UGE0 Ncbi_pid 6624592 ENSG00000206168 situated very close is a processed pseudo gene


Relationship
Family|LYsophospholipase_carboxylesterase
Block| X
Position in NCBI Life Tree|Homo sapiens
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Primates: N E > Haplorrhini: N E > Simiiformes: N E > Catarrhini: N E > Hominoidea: N E > Hominidae: N E > Homininae: N E > Homo: N E > Homo sapiens: N E


Molecular evidence
Database
>3 Genbank links 3 more: AF098668, CAB40158, AL031295
>3 UniProt links 4 more: O95372, Q5QPN5, Q5QPQ1
2 Ncbi-nid : 4581413, 3859559
3 Ncbi-pid : 4581413, 3859560, 6624592
2 Structure : 6BJE, 5SYN
>3 UniProt links 4 more: O95372, Q5QPN5, Q5QPQ1
>3 Interpro links 4 more: O95372, Q5QPN5, Q5QPQ1
>3 Prodom links 4 more: O95372, Q5QPN5, Q5QPQ1
>3 Pfam links 4 more: O95372, Q5QPN5, Q5QPQ1
>3 PIRSF links 4 more: O95372, Q5QPN5, Q5QPQ1
>3 SUPERFAM links 4 more: O95372, Q5QPN5, Q5QPQ1
1 EntrezGene : 11313
1 SNP : 11313
1 UniGene : 533479
1 HUGO HGNC : 6738
1 OMIM : 616143
1 Ensembl : ENSG00000011009
Sequence
Graphical view for this peptide sequence: human-LYPLA2
Colored MSA for LYsophospholipase_carboxylesterase (raw)
MCGNTMSVPLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLP
HVKYICPHAPRIPVTLNMKMVMPSWFDLMGLSPDAPEDEAGIKKAAENIK
ALIEHEMKNGIPANRIVLGGFSQGGALSLYTALTCPHPLAGIVALSCWLP
LHRAFPQAANGSAKDLAILQCHGELDPMVPVRFGALTAEKLRSVVTPARV
QFKTYPGVMHSSCPQEMAAVKEFLEKLLPPV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MCGNTMSVPLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLP
HVKYICPHAPRIPVTLNMKMVMPSWFDLMGLSPDAPEDEAGIKKAAENIK
ALIEHEMKNGIPANRIVLGGFSQGGALSLYTALTCPHPLAGIVALSCWLP
LHRAFPQAANGSAKDLAILQCHGELDPMVPVRFGALTAEKLRSVVTPARV
QFKTYPGVMHSSCPQEMAAVKEFLEKLLPPV


References
4 more
    Title: Palmitoylated acyl protein thioesterase APT2 deforms membranes to extract substrate acyl chains
    Abrami L, Audagnotto M, Ho S, Marcaida MJ, Mesquita FS, Anwar MU, Sandoz PA, Fonti G, Pojer F and van der Goot FG <1 more author(s)>
    Ref: Nat Chemical Biology, 17:438, 2021 : PubMed

            

    Title: Lysophospholipases cooperate to mediate lipid homeostasis and lysophospholipid signaling
    Wepy JA, Galligan JJ, Kingsley PJ, Xu S, Goodman MC, Tallman KA, Rouzer CA, Marnett LJ
    Ref: J Lipid Res, 60:360, 2019 : PubMed

            

    Title: Identification of the major prostaglandin glycerol ester hydrolase in human cancer cells
    Manna JD, Wepy JA, Hsu KL, Chang JW, Cravatt BF, Marnett LJ
    Ref: Journal of Biological Chemistry, 289:33741, 2014 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer