human-MEST

 
Homo sapiens (Human) MEST mesoderm-specific transcript

Relationship
Family MEST-like
Block X
Homo sapiens position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Primates: N E > Haplorrhini: N E > Simiiformes: N E > Catarrhini: N E > Hominoidea: N E > Hominidae: N E > Homininae: N E > Homo: N E > Homo sapiens: N E

Molecular evidence
Database
No mutation
No structure
No kinetic



>3 Genbank links 13 more: D78611, CR627364, BC090049
2 UniProt : Q5EB52, C9JRA9
1 Ncbi-nid : 1655421
1 Ncbi-pid : 1655422
>3 UniProtTrembl links 5 more: Q5EB52, C9JRA9, C9JCM6
>3 Interpro links 5 more: Q5EB52, C9JRA9, C9JCM6
>3 Prodom links 5 more: Q5EB52, C9JRA9, C9JCM6
>3 Pfam links 5 more: Q5EB52, C9JRA9, C9JCM6
>3 PIRSF links 5 more: Q5EB52, C9JRA9, C9JCM6
>3 SUPERFAM links 5 more: Q5EB52, C9JRA9, C9JCM6
>3 QuickSwissBlast links 5 more: Q5EB52, C9JRA9, C9JCM6
1 EntrezGene : 4232
1 SNP : 4232
1 UniGene : 270978
1 HUGO HGNC : 7028
1 OMIM : 601029
1 Ensembl : ENSG00000106484
 
Sequence
Graphical view for this peptide sequence: human-MEST
Colored MSA for MEST-like (raw)
MVRRDRLRRMREWWVQVGLLAVPLLAAYLHIPPPQLSPALHSWKSSGKFF
TYKGLRIFYQDSVGVVGSPEIVVLLHGFPTSSYDWYKIWKGLTLRFHRVI
ALDFLGFGFSDKPRPHHYSIFEQASIVEALLRHLGLQNRRINLLSHDYGD
IVAQELLYRYKQNRSGRHTIKSLCLSNGGIFPETHRPLLLQKLLKDGGVL
SPILTRLMNFFVFSRGLTPVFGPYTRPSESELWDMWAGIRNNDGNLVIDS
LLQYINQRKKFRRRWVGALASVTIPIHFIYGPLDPVNPYPEFLELYRKTL
PRSTVSILDDHISHYPQLEDPMGFLNAYMGFINSF
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MVRRDRLRRMREWWVQVGLLAVPLLAAYLHIPPPQLSPALHSWKSSGKFF
TYKGLRIFYQDSVGVVGSPEIVVLLHGFPTSSYDWYKIWKGLTLRFHRVI
ALDFLGFGFSDKPRPHHYSIFEQASIVEALLRHLGLQNRRINLLSHDYGD
IVAQELLYRYKQNRSGRHTIKSLCLSNGGIFPETHRPLLLQKLLKDGGVL
SPILTRLMNFFVFSRGLTPVFGPYTRPSESELWDMWAGIRNNDGNLVIDS
LLQYINQRKKFRRRWVGALASVTIPIHFIYGPLDPVNPYPEFLELYRKTL
PRSTVSILDDHISHYPQLEDPMGFLNAYMGFINSF

Graphical view for this nucleotide DNA sequence (2538 bp): human-MEST



References
14 more
    Title: Mesoderm-specific transcript is associated with fat mass expansion in response to a positive energy balance
    Nikonova L, Koza RA, Mendoza T, Chao PM, Curley JP, Kozak LP
    Ref: FASEB Journal, 22:3925, 2008 : PubMed

            

    Title: Genomic imprinting and chromosomal localization of the human MEST gene
    Nishita Y, Yoshida I, Sado T, Takagi N
    Ref: Genomics, 36:539, 1996 : PubMed

            

    Title: A novel mesoderm-specific cDNA isolated from a mouse embryonal carcinoma cell line
    Sado T, Nakajima N, Tada M, Takagi N
    Ref: Dev Growth Differ, 35:551, 1993 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer