Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: human-OVCA2

Homo sapiens (Human) Candidate tumor suppressor in ovarian cancer

Comment
human-OVCA2 Human Candidate tumor suppressor in ovarian cancer and yeast-FSH3 regulated by the Crt1 transcription factor, an effector of the DNA damage checkpoint pathway in Saccharomyces cerevisiae, may be involved in folate metabolism. OVCA2 has a strong preference for long-chain alkyl ester substrates (>10-carbons) and high selectivity against a variety of short, branched, and substituted esters Bun et al. 2020


Relationship
Family|FSH1
Block| X
Position in NCBI Life Tree|Homo sapiens
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Primates: N E > Haplorrhini: N E > Simiiformes: N E > Catarrhini: N E > Hominoidea: N E > Hominidae: N E > Homininae: N E > Homo: N E > Homo sapiens: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 1 more: AF321875, AF335321, BC041170
1 UniProt : Q8WZ82
1 UniProt : Q8WZ82
1 Interpro : Q8WZ82
1 Prodom : Q8WZ82
1 Pfam : Q8WZ82
1 PIRSF : Q8WZ82
1 SUPERFAM : Q8WZ82
1 EntrezGene : 124641
1 SNP : 124641
1 UniGene : 513856
1 HUGO HGNC : 24203
1 OMIM : 607896
1 Ensembl : ENSG00000262664
Sequence
Graphical view for this peptide sequence: human-OVCA2
Colored MSA for FSH1 (raw)
MAAQRPLRVLCLAGFRQSERGFREKTGALRKALRGRAELVCLSGPHPVPD
PPGPEGARSDFGSCPPEEQPRGWWFSEQEADVFSALEEPAVCRGLEESLG
MVAQALNRLGPFDGLLGFSQGAALAALVCALGQAGDPRFPLPRFILLVSG
FCPRGIGFKESILQRPLSLPSLHVFGDTDKVIPSQESVQLASQFPGAITL
THSGGHFIPAAAPQRQAYLKFLDQFAE
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAAQRPLRVLCLAGFRQSERGFREKTGALRKALRGRAELVCLSGPHPVPD
PPGPEGARSDFGSCPPEEQPRGWWFSEQEADVFSALEEPAVCRGLEESLG
MVAQALNRLGPFDGLLGFSQGAALAALVCALGQAGDPRFPLPRFILLVSG
FCPRGIGFKESILQRPLSLPSLHVFGDTDKVIPSQESVQLASQFPGAITL
THSGGHFIPAAAPQRQAYLKFLDQFAE


References
1 more
    Title: Comparative analysis of the human serine hydrolase OVCA2 to the model serine hydrolase homolog FSH1 from S. cerevisiae
    Bun JS, Slack MD, Schemenauer DE, Johnson RJ
    Ref: PLoS ONE, 15:e0230166, 2020 : PubMed

            

    Title: OVCA2 is downregulated and degraded during retinoid-induced apoptosis
    Prowse AH, Vanderveer L, Milling SW, Pan ZZ, Dunbrack RL, Xu XX, Godwin AK
    Ref: International Journal of Cancer, 99:185, 2002 : PubMed

            

    Title: Identification of two candidate tumor suppressor genes on chromosome 17p13.3
    Schultz DC, Vanderveer L, Berman DB, Hamilton TC, Wong AJ, Godwin AK
    Ref: Cancer Research, 56:1997, 1996 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer