human-PLA1A

 
Homo sapiens (Human) Phospholipase A1 member A, phosphatidylserine-specific phospholipase A1 deltaC

Comment
Hydrolyzes the ester bond at the sn-1 position of glycerophospholipids and produces 2-acyl lysophospholipids. Hydrolyzes phosphatidylserine (PS) in the form of liposomes and 1-acyl-2 lysophosphatidylserine (lyso-PS), but not triolein, phosphatidylcholine (PC), phosphatidylethanolamine (PE), phosphatidic acid (PA) or phosphatidylinositol (PI). alternative splicing Q86WX6. old human-psplip


Relationship
Block L
Homo sapiens position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Primates: N E > Haplorrhini: N E > Simiiformes: N E > Catarrhini: N E > Hominoidea: N E > Hominidae: N E > Homininae: N E > Homo: N E > Homo sapiens: N E

Molecular evidence
Database
No mutation
No structure
No kinetic

Substrate: Lysophosphatidylserine ,

>3 Genbank links 4 more: NP_056984, AF035269, U37591
2 UniProt : Q53H76, H7C4H1
1 Ncbi-nid : 4090961
1 Ncbi-pid : 4090962
3 UniProtTrembl : G5E9W0, Q53H76, H7C4H1
3 Interpro : G5E9W0, Q53H76, H7C4H1
3 Prodom : G5E9W0, Q53H76, H7C4H1
3 Pfam : G5E9W0, Q53H76, H7C4H1
3 PIRSF : G5E9W0, Q53H76, H7C4H1
3 SUPERFAM : G5E9W0, Q53H76, H7C4H1
3 QuickSwissBlast : G5E9W0, Q53H76, H7C4H1
1 EntrezGene : 51365
1 SNP : 51365
1 UniGene : 437451
1 HUGO HGNC : 17661
1 OMIM : 607460
1 Ensembl : ENSG00000144837
 
Sequence
Graphical view for this peptide sequence: human-PLA1A
Colored MSA for Phospholipase (raw)
MPPGPWESCFWVGGLILWLSVGSSGDAPPTPQPKCADFQSANLFEGTDLK
VQFLLFVPSNPSCGQLVEGSSDLQNSGFNATLGTKLIIHGFRVLGTKPSW
IDTFIRTLLRATNANVIAVDWIYGSTGVYFSAVKNVIKLSLEISLFLNKL
LVLGVSESSIHIIGVSLGAHVGGMVGQLFGGQLGQITGLDPAGPEYTRAS
VEERLDAGDALFTEAIHTDTDNLGIRIPVGHVDYFVNGGQDQPGCPTFFY
AGYSYLICDHMRAVHLYISALENSCPLMAFPCASYKAFLAGRCLDCFNPF
LLSCPRIGLVEQGGVKIEPLPKEVKVYLLTTSSAPYCMHHSLVEFHLKEL
RNKDTNIEVTFLSSNITSSSKITIPKQQRYGKGIIAHATPQCQINQVKFK
FQSSNRVWKKDRTTIIGKFCTALLPVNDREKMVCLPEPVNLQASVTVSCD
LKIACV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MPPGPWESCFWVGGLILWLSVGSSGDAPPTPQPKCADFQSANLFEGTDLK
VQFLLFVPSNPSCGQLVEGSSDLQNSGFNATLGTKLIIHGFRVLGTKPSW
IDTFIRTLLRATNANVIAVDWIYGSTGVYFSAVKNVIKLSLEISLFLNKL
LVLGVSESSIHIIGVSLGAHVGGMVGQLFGGQLGQITGLDPAGPEYTRAS
VEERLDAGDALFTEAIHTDTDNLGIRIPVGHVDYFVNGGQDQPGCPTFFY
AGYSYLICDHMRAVHLYISALENSCPLMAFPCASYKAFLAGRCLDCFNPF
LLSCPRIGLVEQGGVKIEPLPKEVKVYLLTTSSAPYCMHHSLVEFHLKEL
RNKDTNIEVTFLSSNITSSSKITIPKQQRYGKGIIAHATPQCQINQVKFK
FQSSNRVWKKDRTTIIGKFCTALLPVNDREKMVCLPEPVNLQASVTVSCD
LKIACV

Graphical view for this nucleotide DNA sequence (1811 bp): human-PLA1A
>human-PLA1A
cacgagcggcacgaggatttccagctcagcgatgcccccaggtccctggg
agagctgcttctgggtggggggcctcattttgtggctcagcgttggaagt
tcaggggatgcacctcctaccccacagccaaagtgcgctgacttccagag
cgccaacctttttgaaggcaccgatctcaaagtccagtttctcctctttg
tcccttcgaatcctagctgtgggcagctagtagaaggaagcagtgacctc
caaaactctgggttcaatgccactctgggaaccaaactaattatccatgg
attcagggttttaggaacaaagccttcctggattgacacatttattagaa
cccttctgcgtgcaacgaatgctaatgtgattgccgtggactggatttat
gggtctacaggagtctacttctcagctgtgaaaaatgtgattaagttgag
cctcgagatctcccttttcctcaataaactcctggtgctgggtgtgtcgg
aatcctcaatccacatcattggtgttagcctgggggcccacgttgggggc
atggtgggacagctcttcggaggccagctgggacagatcacaggcctgga
ccccgctggacctgagtacaccagggccagtgtggaagagcgcttggatg
ctggagatgccctcttcgtggaagccatccacacagacaccgacaatttg
ggtattcggattcccgttggacatgtggactacttcgtcaacggaggcca
agaccaacctggctgccccaccttcttttacgcaggttatagttatctga
tctgtgatcacatgagggctgtgcacctctacatcagcgccctggagaat
tcctgtccactgatggcctttccctgtgccagctacaaggccttccttgc
tggacgctgtctggattgctttaacccttttctgctttcctgcccaagga
taggactggtggaacaaggtggtgtcaagatagagccgctccccaaggaa
gtgaaagtctacctcctgactacttccagtgctccgtactgcatgcatca
cagcctcgtggagtttcacttgaaggaactgagaaacaaggacaccaaca
tcgaggttaccttccttagcagtaacatcacctcttcatctaagatcacc
atgtacacctaagcagcaacgctatgggaaaggaatcatagcccatgcca
ccccacaatgccagataaaccaagtgaaattcaagtttcagtcttccaac
cgagtttggaaaaaagaccggactaccattattgggaagttctgcactgc
ccttttgcctgtcaatgacagagaaaagatggtctgcttacctgaaccag
tgaacttacaagcaagtgtgactgtttcctgtgacctgaagatagcctgt
gtgtagtttaacctgggcaggacacatctccctgcatttttttttttttt
ttttgagagagaggtgtgatgagggatgtgtgtgtgcagcttattgtaga
ccattactactaaggagaaaagcaaagctctttcttattttcctcataat
cagctaccctggaggggagggagaactcattttacagaacttggtttcct
ttgccgatcttatgtacatacccattttagctttcccatgcatacttaac
tgcacttgctttatctccttgggcattcgtacttaggattcaatagaaac
atgtacagggtaaacaattttttaaaaataaaacttcatggagtaaaaaa
aaaaaaaaaaaa



References
2 more
    Title: An alternative splicing form of phosphatidylserine-specific phospholipase A1 that exhibits lysophosphatidylserine-specific lysophospholipase activity in humans
    Nagai Y, Aoki J, Sato T, Amano K, Matsuda Y, Arai H and
    Ref: Journal of Biological Chemistry, 274:11053, 1999 : PubMed

            

    Title: Construction and characterization of a full length-enriched and a 5'-end-enriched cDNA library
    Suzuki Y, Yoshitomo-Nakagawa K, Maruyama K, Suyama A, Sugano S
    Ref: Gene, 200:149, 1997 : PubMed

            

    Title: Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides
    Maruyama K, Sugano S
    Ref: Gene, 138:171, 1994 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer