human-PLA2G15

 
Homo sapiens (Human) Group XV phospholipase A2 lcat-like lysophospholipase (llpl) (unq341/pro540)

Comment
Hypothetical protein FLJ90347 HGNC:17163; LYPLA3


Relationship
Block L
Homo sapiens position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Primates: N E > Haplorrhini: N E > Simiiformes: N E > Catarrhini: N E > Hominoidea: N E > Hominidae: N E > Homininae: N E > Homo: N E > Homo sapiens: N E

Molecular evidence
Database
No mutation
8 structures (e.g. : 6MTW, 4X91, 4X90... more)
No kinetic


Inhibitor: Methyl-arachidonyl-fluorophosphonate , IDFPen ,
>3 Genbank links 9 more: AB017494, AK074828, AY358425
3 UniProt : B4DJW4, Q8NCC3, B4DPU0
>3 Structure links 5 more: 6MTW, 4X91, 4X90
3 UniProtTrembl : Q8NCC3, B4DJW4, B4DPU0
3 Interpro : Q8NCC3, B4DJW4, B4DPU0
3 Prodom : Q8NCC3, B4DJW4, B4DPU0
3 Pfam : Q8NCC3, B4DJW4, B4DPU0
3 PIRSF : Q8NCC3, B4DJW4, B4DPU0
3 SUPERFAM : Q8NCC3, B4DJW4, B4DPU0
3 QuickSwissBlast : Q8NCC3, B4DJW4, B4DPU0
1 EntrezGene : 23659
1 SNP : 23659
1 UniGene : 632199
1 HUGO HGNC : 17163
1 OMIM : 609362
1 Ensembl : ENSG00000103066
 
Sequence
Graphical view for this peptide sequence: human-PLA2G15
Colored MSA for PC-sterol_acyltransferase (raw)
MGLHLRPYRVGLLPDGLLFLLLLLMLLADPALPAGRHPPVVLVPGDLGNQ
LEAKLDKPTVVHYLCSKKTESYFTIWLNLELLLPVIIDCWIDNIRLVYNK
TSRATQFPDGVDVRVPGFGKTFSLEFLDPSKSSVGSYFHTMVESLVGWGY
TRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQLYGGPVVLVAHSMG
NMYTLYFLQRQPQAWKDKYIRAFVSLGAPWGGVAKTLRVLASGDNNRIPV
IGPLKIREQQRSAVSTSWLLPYNYTWSPEKVFVQTPTINYTLRDYRKFFQ
DIGFEDGWLMRQDTEGLVEATMPPGVQLHCLYGTGVPTPDSFYYESFPDR
DPKICFGDGDGTVNLKSALQCQAWQSRQEHQVLLQELPGSEHIEMLANAT
TLAYLKRVLLGP
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGLHLRPYRVGLLPDGLLFLLLLLMLLADPALPAGRHPPVVLVPGDLGNQ
LEAKLDKPTVVHYLCSKKTESYFTIWLNLELLLPVIIDCWIDNIRLVYNK
TSRATQFPDGVDVRVPGFGKTFSLEFLDPSKSSVGSYFHTMVESLVGWGY
TRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQLYGGPVVLVAHSMG
NMYTLYFLQRQPQAWKDKYIRAFVSLGAPWGGVAKTLRVLASGDNNRIPV
IGPLKIREQQRSAVSTSWLLPYNYTWSPEKVFVQTPTINYTLRDYRKFFQ
DIGFEDGWLMRQDTEGLVEATMPPGVQLHCLYGTGVPTPDSFYYESFPDR
DPKICFGDGDGTVNLKSALQCQAWQSRQEHQVLLQELPGSEHIEMLANAT
TLAYLKRVLLGP

no DNA




References
5 more
    Title: Signal peptide prediction based on analysis of experimentally verified cleavage sites
    Zhang Z, Henzel WJ
    Ref: Protein Science, 13:2819, 2004 : PubMed

            

    Title: Cloning and characterization of a lysosomal phospholipase A2, 1-O-acylceramide synthase
    Hiraoka M, Abe A, Shayman JA
    Ref: Journal of Biological Chemistry, 277:10090, 2002 : PubMed

            

    Title: Cloning and expression of a novel lysophospholipase which structurally resembles lecithin cholesterol acyltransferase
    Taniyama Y, Shibata S, Kita S, Horikoshi K, Shirafuji H, Sumino Y, Fujino M, Fuse H
    Ref: Biochemical & Biophysical Research Communications, 257:50, 1999 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer