human-PNLIPRP1

 
Homo sapiens (Human) pancreatic lipase related protein 1

Comment
also clone MGC:12257 BC005233 13528867


Relationship
Block L
Homo sapiens position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Primates: N E > Haplorrhini: N E > Simiiformes: N E > Catarrhini: N E > Hominoidea: N E > Hominidae: N E > Homininae: N E > Homo: N E > Homo sapiens: N E

Molecular evidence
Database
No mutation
1 structure:
2PPL: Human Pancreatic lipase-related protein 1
No kinetic



>3 Genbank links 4 more: M93283, BC005233, BC025784
>3 UniProt links 6 more: P54315, E7EX42, E9PJC9
1 Ncbi-nid : 187229
1 Structure : 2PPL
>3 UniProtTrembl links 6 more: P54315, E7EX42, E9PJC9
>3 Interpro links 6 more: P54315, E7EX42, E9PJC9
>3 Prodom links 6 more: P54315, E7EX42, E9PJC9
>3 Pfam links 6 more: P54315, E7EX42, E9PJC9
>3 PIRSF links 6 more: P54315, E7EX42, E9PJC9
>3 SUPERFAM links 6 more: P54315, E7EX42, E9PJC9
>3 QuickSwissBlast links 6 more: P54315, E7EX42, E9PJC9
1 EntrezGene : 5407
1 SNP : 5407
1 UniGene : 73923
1 HUGO HGNC : 9156
1 OMIM : 604422
1 Ensembl : ENSG00000187021
 
Sequence
Graphical view for this peptide sequence: human-PNLIPRP1
Colored MSA for Pancreatic_lipase (raw)
MLIFWTITLFLLGAAKGKEVCYEDLGCFSDTEPWGGTAIRPLKILPWSPE
KIGTRFLLYTNENPNNFQILLLSDPSTIEASNFQMDRKTRFIIHGFIDKG
DESWVTDMCKKLFEVEEVNCICVDWKKGSQATYTQAANNVRVVGAQVAQM
LDILLTEYSYPPSKVHLIGHSLGAHVAGEAGSKTPGLSRITGLDPVEASF
ESTPEEVRLDPSDADFVDVIHTDAAPLIPFLGFGTNQQMGHLDFFPNGGE
SMPGCKKNALSQIVDLDGIWAGTRDFVACNHLRSYKYYLESILNPDGFAA
YPCTSYKSFESDKCFPCPDQGCPQMGHYADKFAGRTSEEQQKFFLNTGEA
SNFARWRYGVSITLSGRTATGQIKVALFGNKGNTHQYSIFRGILKPGSTH
SYEFDAKLDVGTIEKVKFLWNNNVINPTLPKVGATKITVQKGEEKTVYNF
CSEDTVREDTLLTLTPC
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MLIFWTITLFLLGAAKGKEVCYEDLGCFSDTEPWGGTAIRPLKILPWSPE
KIGTRFLLYTNENPNNFQILLLSDPSTIEASNFQMDRKTRFIIHGFIDKG
DESWVTDMCKKLFEVEEVNCICVDWKKGSQATYTQAANNVRVVGAQVAQM
LDILLTEYSYPPSKVHLIGHSLGAHVAGEAGSKTPGLSRITGLDPVEASF
ESTPEEVRLDPSDADFVDVIHTDAAPLIPFLGFGTNQQMGHLDFFPNGGE
SMPGCKKNALSQIVDLDGIWAGTRDFVACNHLRSYKYYLESILNPDGFAA
YPCTSYKSFESDKCFPCPDQGCPQMGHYADKFAGRTSEEQQKFFLNTGEA
SNFARWRYGVSITLSGRTATGQIKVALFGNKGNTHQYSIFRGILKPGSTH
SYEFDAKLDVGTIEKVKFLWNNNVINPTLPKVGATKITVQKGEEKTVYNF
CSEDTVREDTLLTLTPC

Graphical view for this nucleotide DNA sequence (1527 bp): human-PNLIPRP1
>human-PNLIPRP1
ctctggaacattagacaggatgctgatcttctggacaatcacacttttcc
tgctgggagcagccaaaggaaaagaagtttgctatgaggacctcgggtgc
ttttctgacactgagccctggggcgggacagcaatcaggcccctgaaaat
tctcccctggagccctgagaagatcggcacccgcttcctgctgtacacca
atgaaaacccaaacaactttcaaattctcctcctctctgatccatcaaca
attgaggcatcaaattttcaaatggacagaaagacccggttcatcatcca
tggcttcatagacaaaggagatgagagctgggtgacagacatgtgcaaga
aactgttcgaggtggaggaggtgaactgcatctgcgtggactggaagaag
ggctcccaagccacctacacacaggctgccaacaacgtgcgagtggtggg
cgcccaggtggcccagatgctcgacatcctcttgacagagtatagctacc
ccccttccaaagttcacctcattggccacagcctgggagcccacgtggct
ggagaggcaggaagcaagactccaggcctgagcaggattacagggttgga
tcctgtagaagcaagtttcgagagtactcctgaagaggtgcgacttgatc
cctctgatgctgactttgttgatgtgattcacacggatgcagctcccctg
atcccattcttgggttttggaacgaaccaacagatgggtcatcttgactt
cttccccaatggaggagagagcatgccgggatgcaagaagaatgccctgt
ctcagatcgtggatctagatggcatctgggcgggaacccgggactttgtg
gcttgcaatcacctaagaagctacaagtattacttggaaagcatcctcaa
tcccgatgggtttgctgcatatccctgcacttcctacaagtcctttgagt
ctgacaagtgcttcccgtgtccagatcaaggatgcccacagatgggtcac
tatgctgataaatttgctggcaggacaagtgaagagcagcagaaattctt
cttgaacacaggagaggctagcaatttcgctcgctggagatatggggttt
ccatcacactgtctggaagaacagccactggtcagatcaaagttgctttg
tttggaaataagggaaacactcaccagtacagcatcttcagggggattct
caaaccaggctcaacccattcctatgagtttgatgcaaagctggatgttg
gaacaattgagaaagtcaagtttctttggaataacaatgtgataaatcca
accctccccaaagtgggtgccaccaagatcactgtgcaaaagggagaaga
gaagacagtgtacaacttctgtagcgaagacacagtgcgggaagacacgc
tgctcaccctcacgccctgctaagctcccggggcgacgaggctgctgcgt
tcacactaataaaatccactggtgcatctgt



References
1 more
    Title: The DNA sequence and comparative analysis of human chromosome 10
    Deloukas P, Earthrowl ME, Grafham DV, Rubenfield M, French L, Steward CA, Sims SK, Jones MC, Searle S and Rogers J <126 more author(s)>
    Ref: Nature, 429:375, 2004 : PubMed

            

    Title: Pancreatic lipase-related protein 1 (PLRP1) is present in the pancreatic juice of several species
    De Caro J, Carriere F, Barboni P, Giller T, Verger R, de Caro A
    Ref: Biochimica & Biophysica Acta, 1387:331, 1998 : PubMed

            

    Title: Two novel human pancreatic lipase related proteins, hPLRP1 and hPLRP2. Differences in colipase dependence and in lipase activity
    Giller T, Buchwald P, Blum-Kaelin D, Hunziker W
    Ref: Journal of Biological Chemistry, 267:16509, 1992 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer