human-PNLIPRP2

 
Homo sapiens (Human) pancreatic lipase related protein 2

Comment
human-PNLIPRP2 adopt in solution an open lid conformation which creates a large cavity capable of accommodating the galactose polar head of galactolipids (Eydoux 2008). q5jyh9 (old) protein (fragment) a dead processed gene (incomplete) nothing close in the genome to complete, RP6149D17.1-001, ENSG00000189372


Relationship
Block L
Homo sapiens position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Primates: N E > Haplorrhini: N E > Simiiformes: N E > Catarrhini: N E > Hominoidea: N E > Hominidae: N E > Homininae: N E > Homo: N E > Homo sapiens: N E

Molecular evidence
Database
No mutation
2 structures: 2PVS, 2OXE
Kinetic: human-PNLIPRP2

Substrate: Retinol-palmitate , Retinol-oleate , KM043 , DGDG , LMGL05010021 , C8-DGDG , C8-MGDG , MGDG , Tributyrin , Egg-Lecithin ,
Inhibitor: Paraoxon , Orlistat ,
>3 Genbank links 2 more: CR456949, M93284, BC005989
1 UniProt : P54317
1 Ncbi-nid : 187231
2 Structure : 2PVS, 2OXE
1 UniProtTrembl : P54317
1 Interpro : P54317
1 Prodom : P54317
1 Pfam : P54317
1 PIRSF : P54317
1 SUPERFAM : P54317
1 QuickSwissBlast : P54317
1 EntrezGene : 5408
1 SNP : 5408
1 UniGene : 423598
1 HUGO HGNC : 9157
1 OMIM : 604423
1 Ensembl : ENSG00000266200
 
Sequence
Graphical view for this peptide sequence: human-PNLIPRP2
Colored MSA for Pancreatic_lipase (raw)
MLPPWTLGLLLLATVRGKEVCYGQLGCFSDEKPWAGTLQRPVKLLPWSPE
DIDTRFLLYTNENPNNFQLITGTEPDTIEASNFQLDRKTRFIIHGFLDKA
EDSWPSDMCKKMFEVEKVNCICVDWRHGSRAMYTQAVQNIRVVGAETAFL
IQALSTQLGYSLEDVHVIGHSLGAHTAAEAGRRLGGRVGRITGLDPAGPC
FQDEPEEVRLDPSDAVFVDVIHTDSSPIVPSLGFGMSQKVGHLDFFPNGG
KEMPGCKKNVLSTITDIDGIWEGIGGFVSCNHLRSFEYYSSSVLNPDGFL
GYPCASYDEFQESKCFPCPAEGCPKMGHYADQFKGKTSAVEQTFFLNTGE
SGNFTSWRYKVSVTLSGKEKVNGYIRIALYGSNENSKQYEIFKGSLKPDA
SHTCAIDVDFNVGKIQKVKFLWNKRGINLSEPKLGASQITVQSGEDGTEY
NFCSSDTVEENVLQSLYPC
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MLPPWTLGLLLLATVRGKEVCYGQLGCFSDEKPWAGTLQRPVKLLPWSPE
DIDTRFLLYTNENPNNFQLITGTEPDTIEASNFQLDRKTRFIIHGFLDKA
EDSWPSDMCKKMFEVEKVNCICVDWRHGSRAMYTQAVQNIRVVGAETAFL
IQALSTQLGYSLEDVHVIGHSLGAHTAAEAGRRLGGRVGRITGLDPAGPC
FQDEPEEVRLDPSDAVFVDVIHTDSSPIVPSLGFGMSQKVGHLDFFPNGG
KEMPGCKKNVLSTITDIDGIWEGIGGFVSCNHLRSFEYYSSSVLNPDGFL
GYPCASYDEFQESKCFPCPAEGCPKMGHYADQFKGKTSAVEQTFFLNTGE
SGNFTSWRYKVSVTLSGKEKVNGYIRIALYGSNENSKQYEIFKGSLKPDA
SHTCAIDVDFNVGKIQKVKFLWNKRGINLSEPKLGASQITVQSGEDGTEY
NFCSSDTVEENVLQSLYPC

Graphical view for this nucleotide DNA sequence (1495 bp): human-PNLIPRP2
>human-PNLIPRP2
atgctgcccccttggaccctcggccttctcctgctggccacagtcagagg
aaaagaggtctgctacggacaacttggctgcttttctgatgaaaaaccat
gggcaggaacccttcagcgacctgtaaaattacttccctggtcccccgag
gacattgacacccgctttcttctgtacacaaatgaaaatccaaacaactt
ccaactaatcactggcacggaaccagacaccattgaggcttcaaacttcc
aactggaccgcaagacacgcttcatcatccatggcttcttagacaaggcg
gaggacagctggccatcggacatgtgcaagaaaatgtttgaagtggagaa
ggtgaactgcatctgtgtggactggaggcacgggtcccgggcaatgtaca
cccaagccgtgcaaaacattcgggttgttggggcggagacagctttctta
atacaagcactgtcgacgcagctagggtacagccttgaggacgtgcatgt
catcggccacagcctgggcgcgcacacggccgcggaggcgggcaggaggc
tggggggccgcgtgggcaggatcacagggctggatccagcagggccgtgc
ttccaggatgaacctgaggaggttcggttggatccatctgacgccgtgtt
tgtggatgtgattcacacagattcttctcccatagttccttccctaggtt
tcggaatgagccaaaaggtgggccatctggatttctttccaaatggagga
aaggaaatgcccggatgtaagaaaaatgtcctttcaaccattactgatat
tgatggaatatgggaaggaattggtggctttgtgtcttgcaatcacctaa
gaagcttcgagtattactcaagcagcgtcctcaaccctgatggcttcctg
ggctatccctgtgcctcctacgatgagtttcaggagagtaagtgtttccc
ttgtccagctgaaggatgccccaaaatggggcactatgctgaccaattta
aggggaaaacaagtgctgtggaacaaacctttttcctgaacacaggagag
agtggtaactttactagttggagatataaggtatcagtcacactttctgg
aaaagagaaagtgaatgggtacatcaggattgctttgtatggaagtaatg
aaaactcgaaacaatatgagattttcaaaggatccctcaaaccagatgca
agtcacacgtgtgctattgatgtggattttaatgttggaaaaatacagaa
agttaaattcctctggaacaaacgtgggataaatctatctgagcccaaac
tgggggcttcccaaatcacagtgcaaagtggtgaagatgggactgagtat
aatttttgtagcagcgacactgtggaagaaaacgtcttgcaatctcttta
cccttgttaaaaacgtggtgcggctattgcggtaataaaatctttaatgc



References
12 more
    Title: The beta5-Loop and Lid Domain Contribute to the Substrate Specificity of Pancreatic Lipase-related Protein 2 (PNLIPRP2)
    Xiao X, Lowe ME
    Ref: Journal of Biological Chemistry, 290:28847, 2015 : PubMed

            

    Title: Pancreatic lipase and pancreatic lipase-related protein 2, but not pancreatic lipase-related protein 1, hydrolyze retinyl palmitate in physiological conditions
    Reboul E, Berton A, Moussa M, Kreuzer C, Crenon I, Borel P
    Ref: Biochimica & Biophysica Acta, 1761:4, 2006 : PubMed

            

    Title: Two novel human pancreatic lipase related proteins, hPLRP1 and hPLRP2. Differences in colipase dependence and in lipase activity
    Giller T, Buchwald P, Blum-Kaelin D, Hunziker W
    Ref: Journal of Biological Chemistry, 267:16509, 1992 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer