human-PNLIPRP3

 
Homo sapiens (Human) Pancreatic lipase-related protein 3

Relationship
Block L
Homo sapiens position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Primates: N E > Haplorrhini: N E > Simiiformes: N E > Catarrhini: N E > Hominoidea: N E > Hominidae: N E > Homininae: N E > Homo: N E > Homo sapiens: N E

Molecular evidence
Database
No mutation
No structure
No kinetic



2 Genbank : AC011328, BC117224
1 UniProt : Q17RR3
1 UniProtTrembl : Q17RR3
1 Interpro : Q17RR3
1 Prodom : Q17RR3
1 Pfam : Q17RR3
1 PIRSF : Q17RR3
1 SUPERFAM : Q17RR3
1 QuickSwissBlast : Q17RR3
1 EntrezGene : 119548
1 SNP : 119548
1 UniGene : 276724
1 HUGO HGNC : 23492
1 Ensembl : ENSG00000203837
 
Sequence
Graphical view for this peptide sequence: human-PNLIPRP3
Colored MSA for Pancreatic_lipase (raw)
MLGIWIVAFLFFGTSRGKEVCYERLGCFKDGLPWTRTFSTELVGLPWSPE
KINTRFLLYTIHNPNAYQEISAVNSSTIQASYFGTDKITRINIAGWKTDG
KWQRDMCNVLLQLEDINCINLDWINGSREYIHAVNNLRVVGAEVAYFIDV
LMKKFEYSPSKVHLIGHSLGAHLAGEAGSRIPGLGRITGLDPAGPFFHNT
PKEVRLDPSDANFVDVIHTNAARILFELGVGTIDACGHLDFYPNGGKHMP
GCEDLITPLLKFNFNAYKKEMASFFDCNHARSYQFYAESILNPDAFIAYP
CRSYTSFKAGNCFFCSKEGCPTMGHFADRFHFKNMKTNGSHYFLNTGSLS
PFARWRHKLSVKLSGSEVTQGTVFLRVGGAVRKTGEFAIVSGKLEPGMTY
TKLIDADVNVGNITSVQFIWKKHLFEDSQNKLGAEMVINTSGKYGYKSTF
CSQDIMGPNILQNLKPC
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MLGIWIVAFLFFGTSRGKEVCYERLGCFKDGLPWTRTFSTELVGLPWSPE
KINTRFLLYTIHNPNAYQEISAVNSSTIQASYFGTDKITRINIAGWKTDG
KWQRDMCNVLLQLEDINCINLDWINGSREYIHAVNNLRVVGAEVAYFIDV
LMKKFEYSPSKVHLIGHSLGAHLAGEAGSRIPGLGRITGLDPAGPFFHNT
PKEVRLDPSDANFVDVIHTNAARILFELGVGTIDACGHLDFYPNGGKHMP
GCEDLITPLLKFNFNAYKKEMASFFDCNHARSYQFYAESILNPDAFIAYP
CRSYTSFKAGNCFFCSKEGCPTMGHFADRFHFKNMKTNGSHYFLNTGSLS
PFARWRHKLSVKLSGSEVTQGTVFLRVGGAVRKTGEFAIVSGKLEPGMTY
TKLIDADVNVGNITSVQFIWKKHLFEDSQNKLGAEMVINTSGKYGYKSTF
CSQDIMGPNILQNLKPC

no DNA




References
    Title: Kinetic properties of mouse pancreatic lipase-related protein-2 suggest the mouse may not model human fat digestion
    Xiao X, Ross LE, Miller RA, Lowe ME
    Ref: J Lipid Res, 52:982, 2011 : PubMed

            

    Title: Novel PNLIPRP3 and DOCK8 gene expression and prognostic implications of DNA loss on chromosome 10q25.3 in hepatocellular carcinoma
    Saelee P, Wongkham S, Puapairoj A, Khuntikeo N, Petmitr S, Chariyalertsak S, Sumethchotimaytha W, Karalak A
    Ref: Asian Pac J Cancer Prev, 10:501, 2009 : PubMed

            

    Title: The DNA sequence and comparative analysis of human chromosome 10
    Deloukas P, Earthrowl ME, Grafham DV, Rubenfield M, French L, Steward CA, Sims SK, Jones MC, Searle S and Rogers J <126 more author(s)>
    Ref: Nature, 429:375, 2004 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer