human-PRSS16

 
Homo sapiens (Human) PRSS16 protease, serine, 16 (thymus) TSSP thymus-specific serine protease precursor (EC 3.4.-.-)

Comment
old human-tssp TSSP_HUMAN also old Gene_locus human-q5w1c0 Trembl Q5W1C0 Homo sapiens (Human) otthump00000039491


Relationship
Block X
Homo sapiens position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Primates: N E > Haplorrhini: N E > Simiiformes: N E > Catarrhini: N E > Hominoidea: N E > Hominidae: N E > Homininae: N E > Homo: N E > Homo sapiens: N E

Molecular evidence
Database
No mutation
No structure
No kinetic



>3 Genbank links 5 more: AF052514, AL021808, AY305025
>3 UniProt links 6 more: Q9NQE7, Q7Z5N5, Q7Z5N7
>3 UniProtTrembl links 6 more: Q9NQE7, Q7Z5N5, Q7Z5N7
>3 Interpro links 6 more: Q9NQE7, Q7Z5N5, Q7Z5N7
>3 Prodom links 6 more: Q9NQE7, Q7Z5N5, Q7Z5N7
>3 Pfam links 6 more: Q9NQE7, Q7Z5N5, Q7Z5N7
>3 PIRSF links 6 more: Q9NQE7, Q7Z5N5, Q7Z5N7
>3 SUPERFAM links 6 more: Q9NQE7, Q7Z5N5, Q7Z5N7
>3 QuickSwissBlast links 6 more: Q9NQE7, Q7Z5N5, Q7Z5N7
1 EntrezGene : 10279
1 SNP : 10279
1 UniGene : 274407
1 HUGO HGNC : 9480
1 OMIM : 607169
1 Ensembl : ENSG00000112812
 
Sequence
Graphical view for this peptide sequence: human-PRSS16
Colored MSA for Prolylcarboxypeptidase (raw)
MAVWLAQWLGPLLLVSLWGLLAPASLLRRLGEHIQQFQESSAQGLGLSLG
PGAAALPKVGWLEQLLDPFNVSDRRSFLQRYWVNDQHWVGQDGPIFLHLG
GEGSLGPGSVMRGHPAALAPAWGALVISLEHRFYGLSIPAGGLEMAQLRF
LSSRLALADVVSARLALSRLFNISSSSPWICFGGSYAGSLAAWARLKFPH
LIFASVASSAPVRAVLDFSEYNDVVSRSLMSTAIGGSLECRAAVSVAFAE
VERRLRSGGAAQAALRTELSACGPLGRAENQAELLGALQALVGGVVQYDG
QTGAPLSVRQLCGLLLGGGGNRSHSTPYCGLRRAVQIVLHSLGQKCLSFS
RAETVAQLRSTEPQLSGVGDRQWLYQTCTEFGFYVTCENPRCPFSQLPAL
PSQLDLCEQVFGLSALSVAQAVAQTNSYYGGQTPGANKVLFVNGDTDPWH
VLSVTQALGSSESTLLIRTGSHCLDMAPERPSDSPSLRLGRQNIFQQLQT
WLKLAKESQIKGEV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAVWLAQWLGPLLLVSLWGLLAPASLLRRLGEHIQQFQESSAQGLGLSLG
PGAAALPKVGWLEQLLDPFNVSDRRSFLQRYWVNDQHWVGQDGPIFLHLG
GEGSLGPGSVMRGHPAALAPAWGALVISLEHRFYGLSIPAGGLEMAQLRF
LSSRLALADVVSARLALSRLFNISSSSPWICFGGSYAGSLAAWARLKFPH
LIFASVASSAPVRAVLDFSEYNDVVSRSLMSTAIGGSLECRAAVSVAFAE
VERRLRSGGAAQAALRTELSACGPLGRAENQAELLGALQALVGGVVQYDG
QTGAPLSVRQLCGLLLGGGGNRSHSTPYCGLRRAVQIVLHSLGQKCLSFS
RAETVAQLRSTEPQLSGVGDRQWLYQTCTEFGFYVTCENPRCPFSQLPAL
PSQLDLCEQVFGLSALSVAQAVAQTNSYYGGQTPGANKVLFVNGDTDPWH
VLSVTQALGSSESTLLIRTGSHCLDMAPERPSDSPSLRLGRQNIFQQLQT
WLKLAKESQIKGEV

no DNA




References
1 more
    Title: Alternatively spliced transcripts of the thymus-specific protease PRSS16 are differentially expressed in human thymus
    Luther C, Wienhold W, Oehlmann R, Heinemann MK, Melms A, Tolosa E
    Ref: Genes Immun, 6:1, 2005 : PubMed

            

    Title: The DNA sequence and analysis of human chromosome 6
    Mungall AJ, Palmer SA, Sims SK, Edwards CA, Ashurst JL, Wilming L, Jones MC, Horton R, Hunt SE and Beck S <161 more author(s)>
    Ref: Nature, 425:805, 2003 : PubMed

            

    Title: Cloning of a novel MHC-encoded serine peptidase highly expressed by cortical epithelial cells of the thymus
    Bowlus CL, Ahn J, Chu T, Gruen JR
    Ref: Cell Immunol, 196:80, 1999 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer