Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: human-SCPEP1

Homo sapiens (Human) serine Retinoid-inducible serine carboxypeptidase RISC SCP1 (EC 3.4.16.-)

Comment
Homo sapiens (Human) dc39 Trembl Q9H2J9 mstp034 Q9H3F0 Serine carboxypeptidase 1 old human-HSCP1 also named MSTP034 AF113214


Relationship
Family|Carboxypeptidase_S10
Block| X
Position in NCBI Life Tree|Homo sapiens
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Primates: N E > Haplorrhini: N E > Simiiformes: N E > Catarrhini: N E > Hominoidea: N E > Hominidae: N E > Homininae: N E > Homo: N E > Homo sapiens: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
1 inhbitor:
Rocaglate-Derived-beta-Lactone-5
>3 Genbank links 3 more: NM_021626, AF282618, AF113214
3 UniProt : Q9H2J9, Q9HB40, B4DP22
2 Ncbi-nid : 11055991, 11640575
2 Ncbi-pid : 11055992, 11640576
3 UniProt : Q9HB40, Q9H2J9, B4DP22
3 Interpro : Q9HB40, Q9H2J9, B4DP22
3 Prodom : Q9HB40, Q9H2J9, B4DP22
3 Pfam : Q9HB40, Q9H2J9, B4DP22
3 PIRSF : Q9HB40, Q9H2J9, B4DP22
3 SUPERFAM : Q9HB40, Q9H2J9, B4DP22
1 EntrezGene : 59342
1 SNP : 59342
1 UniGene : 514950
1 HUGO HGNC : 29507
1 IUPHAR : 1585
1 Ensembl : ENSG00000121064
Sequence
Graphical view for this peptide sequence: human-SCPEP1
Colored MSA for Carboxypeptidase_S10 (raw)
MELALRRSPVPRWLLLLPLLLGLNAGAVIDWPTEEGKEVWDYVTVRKDAY
MFWWLYYATNSCKNFSELPLVMWLQGGPGGSSTGFGNFEEIGPLDSDLKP
RKTTWLQAASLLFVDNPVGTGFSYVNGSGAYAKDLAMVASDMMVLLKTFF
SCHKEFQTVPFYIFSESYGGKMAAGIGLELYKAIQRGTIKCNFAGVALGD
SWISPVDSVLSWGPYLYSMSLLEDKGLAEVSKVAEQVLNAVNKGLYREAT
ELWGKAEMIIEQNTDGVNFYNILTKSTPTSTMESSLEFTQSHLVCLCQRH
VRHLQRDALSQLMNGPIRKKLKIIPEDQSWGGQATNVFVNMEEDFMKPVI
SIVDELLEAGINVTVYNGQLDLIVDTMGQEAWVRKLKWPELPKFSQLKWK
ALYSDPKSLETSAFVKSYKNLAFYWILKAGHMVPSDQGDMALKMMRLVTQ
QE
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MELALRRSPVPRWLLLLPLLLGLNAGAVIDWPTEEGKEVWDYVTVRKDAY
MFWWLYYATNSCKNFSELPLVMWLQGGPGGSSTGFGNFEEIGPLDSDLKP
RKTTWLQAASLLFVDNPVGTGFSYVNGSGAYAKDLAMVASDMMVLLKTFF
SCHKEFQTVPFYIFSESYGGKMAAGIGLELYKAIQRGTIKCNFAGVALGD
SWISPVDSVLSWGPYLYSMSLLEDKGLAEVSKVAEQVLNAVNKGLYREAT
ELWGKAEMIIEQNTDGVNFYNILTKSTPTSTMESSLEFTQSHLVCLCQRH
VRHLQRDALSQLMNGPIRKKLKIIPEDQSWGGQATNVFVNMEEDFMKPVI
SIVDELLEAGINVTVYNGQLDLIVDTMGQEAWVRKLKWPELPKFSQLKWK
ALYSDPKSLETSAFVKSYKNLAFYWILKAGHMVPSDQGDMALKMMRLVTQ
QE


References
    Title: Remodeling natural products: chemistry and serine hydrolase activity of a rocaglate-derived beta-lactone
    Lajkiewicz NJ, Cognetta AB, 3rd, Niphakis MJ, Cravatt BF, Porco JA, Jr.
    Ref: Journal of the American Chemical Society, 136:2659, 2014 : PubMed

            

    Title: Signal peptide prediction based on analysis of experimentally verified cleavage sites
    Zhang Z, Henzel WJ
    Ref: Protein Science, 13:2819, 2004 : PubMed

            

    Title: Identification and quantification of N-linked glycoproteins using hydrazide chemistry, stable isotope labeling and mass spectrometry
    Zhang H, Li XJ, Martin DB, Aebersold R
    Ref: Nat Biotechnol, 21:660, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer