Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: human-SERHL2

Homo sapiens (Human) serine hydrolase-like protein 2 SERHL2 chomosome 22

Comment
This gene may have been partially duplicated (AC Q9NQF3) may be a pseudogene. In mouse, induced by passive stretch of skeletal muscle in vivo (Sadusky et al) Testis secretory sperm-binding protein Li 216e. Similar to drosophila kraken-like


Relationship
Family|SERHL
Block| X
Position in NCBI Life Tree|Homo sapiens
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Primates: N E > Haplorrhini: N E > Simiiformes: N E > Catarrhini: N E > Hominoidea: N E > Hominidae: N E > Homininae: N E > Homo: N E > Homo sapiens: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 19 more: AK094872, CH471095, BC119650
>3 UniProt links 5 more: Q9H4I8, Q9NQF3, A6ND93
1 Ncbi-nid : 11322747
1 Ncbi-pid : 11322748
>3 UniProt links 17 more: B1AHE9, B1AHF0, Q0VDJ1
>3 Interpro links 17 more: B1AHE9, B1AHF0, Q0VDJ1
>3 Prodom links 17 more: B1AHE9, B1AHF0, Q0VDJ1
>3 Pfam links 17 more: B1AHE9, B1AHF0, Q0VDJ1
>3 PIRSF links 17 more: B1AHE9, B1AHF0, Q0VDJ1
>3 SUPERFAM links 17 more: B1AHE9, B1AHF0, Q0VDJ1
1 EntrezGene : 253190
1 SNP : 253190
1 UniGene : 728878
1 HUGO HGNC : 29446
1 OMIM : 607979
1 Ensembl : ENSG00000183569
Sequence
Graphical view for this peptide sequence: human-SERHL2
Colored MSA for SERHL (raw)
MSENAAPGLISELKLAVPWGHIAAKAWGSLQGPPVLCLHGWLDNASSFDR
LIPLLPQDFYYVAMDFGGHGLSSHYSPGVPYYLQTFVSEIRRVVAALKWN
RFSILGHSFGGVVGGMFFCTFPEMVDKLILLDTPLFLLESDEMENLLTYK
RRAIEHVLQVEASQEPSHVFSLKQLLQRLLKSNSHLSEECGELLLQRGTT
KVATGLVLNRDQRLAWAENSIDFISRELCAHSIRKLQAHVLLIKAVHGYF
DSRQNYSEKESLSFMIDTMKSTLKEQFQFVEVPGNHCVHMSEPQHVASII
SSFLQCTHMLPAQL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSENAAPGLISELKLAVPWGHIAAKAWGSLQGPPVLCLHGWLDNASSFDR
LIPLLPQDFYYVAMDFGGHGLSSHYSPGVPYYLQTFVSEIRRVVAALKWN
RFSILGHSFGGVVGGMFFCTFPEMVDKLILLDTPLFLLESDEMENLLTYK
RRAIEHVLQVEASQEPSHVFSLKQLLQRLLKSNSHLSEECGELLLQRGTT
KVATGLVLNRDQRLAWAENSIDFISRELCAHSIRKLQAHVLLIKAVHGYF
DSRQNYSEKESLSFMIDTMKSTLKEQFQFVEVPGNHCVHMSEPQHVASII
SSFLQCTHMLPAQL


References
1 more
    Title: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)
    Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R and Malek J <104 more author(s)>
    Ref: Genome Res, 14:2121, 2004 : PubMed

            

    Title: Identification of Serhl, a new member of the serine hydrolase family induced by passive stretch of skeletal muscle in vivo
    Sadusky TJ, Kemp TJ, Simon M, Carey N, Coulton GR
    Ref: Genomics, 73:38, 2001 : PubMed

            

    Title: The DNA sequence of human chromosome 22
    Dunham I, Hunt AR, Collins JE, Bruskiewich R, Beare DM, Clamp M, Smink LJ, Ainscough R, Almeida JP and O'Brien KP <207 more author(s)>
    Ref: Nature, 402:489, 1999 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer