Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: human-TMCO4

Homo sapiens (Human) Transmembrane and coiled-coil domain-containing protein 4

Relationship
Family|Duf_726
Block| X
Position in NCBI Life Tree|Homo sapiens
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Primates: N E > Haplorrhini: N E > Simiiformes: N E > Catarrhini: N E > Hominoidea: N E > Hominidae: N E > Homininae: N E > Homo: N E > Homo sapiens: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 11 more: AK127543, BX640987, AL031727
2 UniProt : Q5TGY1, H0YBR7
3 UniProt : Q5TGY1, Q6ZSC6, H0YBR7
3 Interpro : Q5TGY1, Q6ZSC6, H0YBR7
3 Prodom : Q5TGY1, Q6ZSC6, H0YBR7
3 Pfam : Q5TGY1, Q6ZSC6, H0YBR7
3 PIRSF : Q5TGY1, Q6ZSC6, H0YBR7
3 SUPERFAM : Q5TGY1, Q6ZSC6, H0YBR7
1 EntrezGene : 255104
1 SNP : 255104
1 UniGene : 656313
1 HUGO HGNC : 27393
1 Ensembl : ENSG00000162542
Sequence
Graphical view for this peptide sequence: human-TMCO4
Colored MSA for Duf_726 (raw)
MAMWNRPCQRLPQQPLVAEPTAEGEPHLPTGRELTEANRFAYAALCGISL
SQLFPEPEHSSFCTEFMAGLVQWLELSEAVLPTMTAFASGLGGEGADVFV
QILLKDPILKDDPTVITQDLLSFSLKDGHYDARARVLVCHMTSLLQVPLE
ELDVLEEMFLESLKEIKEEESEMAEASRKKKENRRKWKRYLLIGLATVGG
GTVIGVTGGLAAPLVAAGAATIIGSAGAAALGSAAGIAIMTSLFGAAGAG
LTGYKMKKRVGAIEEFTFLPLTEGRQLHITIAVTGWLASGKYRTFSAPWA
ALAHSREQYCLAWEAKYLMELGNALETILSGLANMVAQEALKYTVLSGIV
AALTWPASLLSVANVIDNPWGVCLHRSAEVGKHLAHILLSRQQGRRPVTL
IGFSLGARVIYFCLQEMAQEKDCQGIIEDVILLGAPVEGEAKHWEPFRKV
VSGRIINGYCRGDWLLSFVYRTSSVQLRVAGLQPVLLQDRRVENVDLTSV
VSGHLDYAKQMDAILKAVGIRTKPGWDEKGLLLAPGCLPSEEPRQAAAAA
SSGETPHQVGQTQGPISGDTSKLAMSTDPSQAQVPVGLDQSEGASLPAAA
SPERPPICSHGMDPNPLGCPDCACKTQGPSTGLD
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAMWNRPCQRLPQQPLVAEPTAEGEPHLPTGRELTEANRFAYAALCGISL
SQLFPEPEHSSFCTEFMAGLVQWLELSEAVLPTMTAFASGLGGEGADVFV
QILLKDPILKDDPTVITQDLLSFSLKDGHYDARARVLVCHMTSLLQVPLE
ELDVLEEMFLESLKEIKEEESEMAEASRKKKENRRKWKRYLLIGLATVGG
GTVIGVTGGLAAPLVAAGAATIIGSAGAAALGSAAGIAIMTSLFGAAGAG
LTGYKMKKRVGAIEEFTFLPLTEGRQLHITIAVTGWLASGKYRTFSAPWA
ALAHSREQYCLAWEAKYLMELGNALETILSGLANMVAQEALKYTVLSGIV
AALTWPASLLSVANVIDNPWGVCLHRSAEVGKHLAHILLSRQQGRRPVTL
IGFSLGARVIYFCLQEMAQEKDCQGIIEDVILLGAPVEGEAKHWEPFRKV
VSGRIINGYCRGDWLLSFVYRTSSVQLRVAGLQPVLLQDRRVENVDLTSV
VSGHLDYAKQMDAILKAVGIRTKPGWDEKGLLLAPGCLPSEEPRQAAAAA
SSGETPHQVGQTQGPISGDTSKLAMSTDPSQAQVPVGLDQSEGASLPAAA
SPERPPICSHGMDPNPLGCPDCACKTQGPSTGLD


References
    Title: The full-ORF clone resource of the German cDNA Consortium
    Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A and Schupp I <9 more author(s)>
    Ref: BMC Genomics, 8:399, 2007 : PubMed

            

    Title: The DNA sequence and biological annotation of human chromosome 1
    Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K and Prigmore E <169 more author(s)>
    Ref: Nature, 441:315, 2006 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer