Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: hyaaz-ACHE1

Hyalella azteca (Amphipod) acetylcholinesterase ace-1, partial

Comment
p.Gly119Ser The nontarget amphipod populations have become resistant to Organophosphate and carbamate insecticides. The terrestrial application of pesticides has provided strong selective pressures to drive evolution in a nontarget, aquatic species


Relationship
Family|ACHE
Block| C
Position in NCBI Life Tree|Hyalella azteca
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Crustacea: N E > Multicrustacea: N E > Malacostraca: N E > Eumalacostraca: N E > Peracarida: N E > Amphipoda: N E > Senticaudata: N E > Talitrida: N E > Talitroidea: N E > Hyalellidae: N E > Hyalella: N E > Hyalella azteca: N E


Molecular evidence
Database
1 mutation: hyaaz-ACHE1
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : KAA0193788
1 UniProt : A0A6A0H1C4
1 UniProt : A0A6A0H1C4
1 Interpro : A0A6A0H1C4
1 Prodom : A0A6A0H1C4
1 Pfam : A0A6A0H1C4
1 PIRSF : A0A6A0H1C4
1 SUPERFAM : A0A6A0H1C4
Sequence
Graphical view for this peptide sequence: hyaaz-ACHE1
Colored MSA for ACHE (raw)
MWCRYLVLALVFTLGTSALHDPLVVNTRKGKVKGKTVKTALGGEVDAWYS
IPFAKPPVGDLRFRHPIPIDRWHDVKDATELPNSCWQTLDDFFGNFEGST
MWNANTPMSEDCLYLSIIVPKPRPTNVPVLVWIYGGGFYSGTSSLEVYDY
RTLADNQNVIIVAPHYRIASLGFLYMGTPDVPGNTGLFDQLMALEWIKDN
IEFFGGNPNNITLMGESAGATSISMLLLSPLSRNLFSQAIMQSGSATVPW
GIMSKKENMLRGQRLAEAVGCPTDMSNPSVVIDCLRSKNASELVNSETSN
GVTDFPFVPIIDGAFFDKLPIEYLRNGDFKKCNILMGSNTEEGYWFIMYF
LPSLFRREENVLITRAEFERSVRALFPYFNELILQAIMYQYTDWIDPEDG
AKNRNAIDKMIGDYHFTCNVNEFAEYYSKSGNNVYMYYFKHRSSGSKWPK
WTGVLHADEISFLFGQPLNPKYTTFTEVEQDLSRQMMTYWGNFIKTGNPS
EGDHRSFAKTKWPLYSPATKEYLILSGEESGLGRGPRLKECAFWKSFLPQ
LVKHSGEIWPVVK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MWCRYLVLALVFTLGTSALHDPLVVNTRKGKVKGKTVKTALGGEVDAWYS
IPFAKPPVGDLRFRHPIPIDRWHDVKDATELPNSCWQTLDDFFGNFEGST
MWNANTPMSEDCLYLSIIVPKPRPTNVPVLVWIYGGGFYSGTSSLEVYDY
RTLADNQNVIIVAPHYRIASLGFLYMGTPDVPGNTGLFDQLMALEWIKDN
IEFFGGNPNNITLMGESAGATSISMLLLSPLSRNLFSQAIMQSGSATVPW
GIMSKKENMLRGQRLAEAVGCPTDMSNPSVVIDCLRSKNASELVNSETSN
GVTDFPFVPIIDGAFFDKLPIEYLRNGDFKKCNILMGSNTEEGYWFIMYF
LPSLFRREENVLITRAEFERSVRALFPYFNELILQAIMYQYTDWIDPEDG
AKNRNAIDKMIGDYHFTCNVNEFAEYYSKSGNNVYMYYFKHRSSGSKWPK
WTGVLHADEISFLFGQPLNPKYTTFTEVEQDLSRQMMTYWGNFIKTGNPS
EGDHRSFAKTKWPLYSPATKEYLILSGEESGLGRGPRLKECAFWKSFLPQ
LVKHSGEIWPVVK


Reference
    Title: The G119S ace-1 mutation confers adaptive organophosphate resistance in a nontarget amphipod
    Major KM, Weston DP, Lydy MJ, Huff Hartz KE, Wellborn GA, Manny AR, Poynton HC
    Ref: Evol Appl, 13:620, 2020 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer