Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: hypjq-cip2

Hypocrea jecorina (strain QM6a) (Trichoderma reesei) Cip2

Comment
n-term Pfam A CBM_1 21 49 and low complexity -> 90 here deleted Other strains: Trichoderma Hypocrea jecorina (strain ATCC 56765 / BCRC 32924 / NRRL 11460 / Rut C-30)


Relationship
Family|Glucuronoyl_esterase
Block| X
Position in NCBI Life Tree|Hypocrea jecorina
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > sordariomyceta: N E > Sordariomycetes: N E > Hypocreomycetidae: N E > Hypocreales: N E > Hypocreaceae: N E > Trichoderma: N E > Trichoderma reesei: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
1 structure:
3PIC: Glucuronoyl Esterase catalytic domain (Cip2_GE) from Hypocrea jecorina
No kinetic





No Substrate
No inhibitor
3 Genbank : AY281368, GL985083, AAP57749
1 UniProt : G0RV93
1 Structure : 3PIC
2 UniProt : G0RV93, A0A024RXL4
2 Interpro : G0RV93, A0A024RXL4
2 Prodom : G0RV93, A0A024RXL4
2 Pfam : G0RV93, A0A024RXL4
2 PIRSF : G0RV93, A0A024RXL4
2 SUPERFAM : G0RV93, A0A024RXL4
Sequence
Graphical view for this peptide sequence: hypjq-cip2
Colored MSA for Glucuronoyl_esterase (raw)
ATCSALPGSITLRSNAKLNDLFTMFNGDKVTTKDKFSCRQAEMSELIQRY
ELGTLPGRPSTLTASFSGNTLTINCGEAGKSISFTVTITYPSSGTAPYPA
IIGYGGGSLPAPAGVAMINFNNDNIAAQVNTGSRGQGKFYDLYGSSHSAG
AMTAWAWGVSRVIDALELVPGARIDTTKIGVTGCSRNGKGAMVAGAFEKR
IVLTLPQESGAGGSACWRISDYLKSQGANIQTASEIIGEDPWFSTTFNSY
VNQVPVLPFDHHSLAALIAPRGLFVIDNNIDWLGPQSCFGCMTAAHMAWQ
ALGVSDHMGYSQIGAHAHCAFPSNQQSQLTAFVQKFLLGQSTNTAIFQSD
FSANQSQWIDWTTPTLS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

ATCSALPGSITLRSNAKLNDLFTMFNGDKVTTKDKFSCRQAEMSELIQRY
ELGTLPGRPSTLTASFSGNTLTINCGEAGKSISFTVTITYPSSGTAPYPA
IIGYGGGSLPAPAGVAMINFNNDNIAAQVNTGSRGQGKFYDLYGSSHSAG
AMTAWAWGVSRVIDALELVPGARIDTTKIGVTGCSRNGKGAMVAGAFEKR
IVLTLPQESGAGGSACWRISDYLKSQGANIQTASEIIGEDPWFSTTFNSY
VNQVPVLPFDHHSLAALIAPRGLFVIDNNIDWLGPQSCFGCMTAAHMAWQ
ALGVSDHMGYSQIGAHAHCAFPSNQQSQLTAFVQKFLLGQSTNTAIFQSD
FSANQSQWIDWTTPTLS


References
2 more
    Title: Structure of the catalytic domain of glucuronoyl esterase Cip2 from Hypocrea jecorina
    Pokkuluri PR, Duke NE, Wood SJ, Cotta MA, Li XL, Biely P, Schiffer M
    Ref: Proteins, 79:2588, 2011 : PubMed

            

    Title: Genome sequencing and analysis of the biomass-degrading fungus Trichoderma reesei (syn. Hypocrea jecorina)
    Martinez D, Berka RM, Henrissat B, Saloheimo M, Arvas M, Baker SE, Chapman J, Chertkov O, Coutinho PM and Brettin TS <35 more author(s)>
    Ref: Nat Biotechnol, 26:553, 2008 : PubMed

            

    Title: Transcriptional regulation of biomass-degrading enzymes in the filamentous fungus Trichoderma reesei
    Foreman PK, Brown D, Dankmeyer L, Dean R, Diener S, Dunn-Coleman NS, Goedegebuur F, Houfek TD, England GJ and Ward M <7 more author(s)>
    Ref: Journal of Biological Chemistry, 278:31988, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer