Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: hypjq-g0r7e2

Hypocrea jecorina (strain QM6a) (Trichoderma reesei) epoxide hydrolase

Relationship
Family|Epoxide_hydrolase
Block| X
Position in NCBI Life Tree|Hypocrea jecorina
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > sordariomyceta: N E > Sordariomycetes: N E > Hypocreomycetidae: N E > Hypocreales: N E > Hypocreaceae: N E > Trichoderma: N E > Trichoderma reesei: N E


Molecular evidence
Database
No mutation
6 structures (e.g. : 5URO, 6N3K, 6N3Z... more)
No kinetic





No Substrate
6 inhibitors (e.g. : 6N3K-1, 6N3Z-4, 6N5F-3... more)
1 UniProt : G0R7E2
>3 Structure links 3 more: 6N3K, 6N3Z, 6N5F
1 UniProt : G0R7E2
1 Interpro : G0R7E2
1 Prodom : G0R7E2
1 Pfam : G0R7E2
1 PIRSF : G0R7E2
1 SUPERFAM : G0R7E2
Sequence
Graphical view for this peptide sequence: hypjq-g0r7e2
Colored MSA for Epoxide_hydrolase (raw)
MDTSKLKPNDPRVKYETKQIRGKTYSYILGEPQGPKLETVVLVHGWPDMA
FGWRHQIPYLMSLGFQVVAPNMLGYAGTDAPRDLSQFTLKSVSADIAELA
RSFVGQDGQIVLGGHDWGGAVVWRTAYYHPELVKAVFSVCTPLHPLSAEY
KPLEDIVAAGHMLNFKYQLQLKGPDVEARIQGKDMLRRFFRAMFGGRGPN
GEAGFSTSDGVHFDVLDKIGAPPLLDEQELEYYVEQYALQEAPELRGPLN
WYRTRELNAKDEMDRAKNGPPLRFEMPALFVAASKDNALPPAMSKGMDAF
YKDLTRAEVDATHWALTQAGDEVNRVIGEWLNKALNGATKAAL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MDTSKLKPNDPRVKYETKQIRGKTYSYILGEPQGPKLETVVLVHGWPDMA
FGWRHQIPYLMSLGFQVVAPNMLGYAGTDAPRDLSQFTLKSVSADIAELA
RSFVGQDGQIVLGGHDWGGAVVWRTAYYHPELVKAVFSVCTPLHPLSAEY
KPLEDIVAAGHMLNFKYQLQLKGPDVEARIQGKDMLRRFFRAMFGGRGPN
GEAGFSTSDGVHFDVLDKIGAPPLLDEQELEYYVEQYALQEAPELRGPLN
WYRTRELNAKDEMDRAKNGPPLRFEMPALFVAASKDNALPPAMSKGMDAF
YKDLTRAEVDATHWALTQAGDEVNRVIGEWLNKALNGATKAAL


References
1 more
    Title: The molecular structure of an epoxide hydrolase from Trichoderma reesei in complex with urea or amide-based inhibitors
    de Oliveira GS, Adriani PP, Ribeiro JA, Morisseau C, Hammock BD, Dias MVB, Chambergo FS
    Ref: Int J Biol Macromol, 129:653, 2019 : PubMed

            

    Title: Substrate and inhibitor selectivity, and biological activity of an epoxide hydrolase from Trichoderma reesei
    de Oliveira GS, Adriani PP, Wu H, Morisseau C, Hammock BD, Chambergo FS
    Ref: Mol Biol Rep, 46:371, 2019 : PubMed

            

    Title: Epoxide hydrolase of Trichoderma reesei: Biochemical properties and conformational characterization
    de Oliveira GS, Adriani PP, Borges FG, Lopes AR, Campana PT, Chambergo FS
    Ref: Int J Biol Macromol, 89:569, 2016 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer