Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: hypsb-hpm3

Hypomyces subiculosus (Nectria subiculosa). Hypothemycin biosynthesis cluster protein hpm3. Thioesterase domain

Relationship
Family|Thioesterase
Block| X
Position in NCBI Life Tree|Hypomyces subiculosus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : EU520418
1 UniProt : B3FWS8
1 UniProt : B3FWS8
1 Interpro : B3FWS8
1 Prodom : B3FWS8
1 Pfam : B3FWS8
1 PIRSF : B3FWS8
1 SUPERFAM : B3FWS8
Sequence
Graphical view for this peptide sequence: hypsb-hpm3
Colored MSA for Thioesterase (raw)
PVKTEVKKISSSESELFHTILESIAKETGTQVSDFTDDMELAELGVDSIM
GIEIAAGVSSRTGLDVLLPSFVVDYPTIGDLRNEFARSSTSTPPSKTFSE
FSIVDATPESTRSSSRAPSEKKEPAPASEKSEELVIVPSAVVEDSSPLPS
ARITLIQGRSSSGKQPFYLIADGAGSIATYIHLAPFKDKRPVYGIDSPFL
RCPSRLTTQVGIEGVAKIIFEALIKCQPEGPFDLGGFSGGAMLSYEVSRQ
LAAAGRVVSSLLLIDMCSPRPLGVEDTIEVGWKVYETIASQDKLWNASSN
TQQHLKAVFACVAAYHPPPITPAQRPKRTAIIWAKKGMVDRCSRDEKVMK
FLADKGIPTESYPGFMEDPKLGAVAWGLPHKSAADLGPNGWDKFLGETLC
LSIDSDHLDMPMPGHVHLLQAAMEESFKYFSEAN
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

PVKTEVKKISSSESELFHTILESIAKETGTQVSDFTDDMELAELGVDSIM
GIEIAAGVSSRTGLDVLLPSFVVDYPTIGDLRNEFARSSTSTPPSKTFSE
FSIVDATPESTRSSSRAPSEKKEPAPASEKSEELVIVPSAVVEDSSPLPS
ARITLIQGRSSSGKQPFYLIADGAGSIATYIHLAPFKDKRPVYGIDSPFL
RCPSRLTTQVGIEGVAKIIFEALIKCQPEGPFDLGGFSGGAMLSYEVSRQ
LAAAGRVVSSLLLIDMCSPRPLGVEDTIEVGWKVYETIASQDKLWNASSN
TQQHLKAVFACVAAYHPPPITPAQRPKRTAIIWAKKGMVDRCSRDEKVMK
FLADKGIPTESYPGFMEDPKLGAVAWGLPHKSAADLGPNGWDKFLGETLC
LSIDSDHLDMPMPGHVHLLQAAMEESFKYFSEAN


References
    Title: Enzymatic synthesis of resorcylic acid lactones by cooperation of fungal iterative polyketide synthases involved in hypothemycin biosynthesis
    Zhou H, Qiao K, Gao Z, Meehan MJ, Li JW, Zhao X, Dorrestein PC, Vederas JC, Tang Y
    Ref: Journal of the American Chemical Society, 132:4530, 2010 : PubMed

            

    Title: Genes for the biosynthesis of the fungal polyketides hypothemycin from Hypomyces subiculosus and radicicol from Pochonia chlamydosporia
    Reeves CD, Hu Z, Reid R, Kealey JT
    Ref: Applied Environmental Microbiology, 74:5121, 2008 : PubMed

            

    Title: Hypothemycin inhibits the proliferative response and modulates the production of cytokines during T cell activation
    Camacho R, Staruch MJ, Dasilva C, Koprak S, Sewell T, Salituro G, Dumont FJ
    Ref: Immunopharmacology, 44:255, 1999 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer