Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: icttr-a0a287cw50

Ictidomys tridecemlineatus (Thirteen-lined ground squirrel) (Spermophilus tridecemlineatus). Hydrolase_4 domain-containing protein

Relationship
Family|abh_upf0017
Block| X
Position in NCBI Life Tree|Ictidomys tridecemlineatus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Sciuromorpha: N E > Sciuridae: N E > Xerinae: N E > Marmotini: N E > Ictidomys: N E > Ictidomys tridecemlineatus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : AGTP01050966, AGTP01050967
2 UniProt : A0A287CW50, I3N357
2 UniProt : A0A287CW50, I3N357
2 Interpro : A0A287CW50, I3N357
2 Prodom : A0A287CW50, I3N357
2 Pfam : A0A287CW50, I3N357
2 PIRSF : A0A287CW50, I3N357
2 SUPERFAM : A0A287CW50, I3N357
Sequence
Graphical view for this peptide sequence: icttr-a0a287cw50
Colored MSA for abh_upf0017 (raw)
MQPWSAALALFLAALALLLLLVPRLQSPWRRAVGARTLPGALFQDDHKEV
KSRGPADKFSDGREPLPGGCSLICKPSALAQCLLRTLRRSAALEPGPRSW
LSGPHLQTLCHFVLPVGPGPELAREYLQLADDGLVALDWVIGPCPRGRRI
TNTGGLPAVLLVIPNAWGRLTRNVLGLCLLALERGYYPVIFHRRGHHGCP
LVSPRLQPFGDPSDLKEAVTYIRFRHPAAPLFAVSEGSGSALLLSYLGEC
GSSSYVTGAACISPVLRCREWFEAGLPWPYERGFLLHQKIALSRYATALE
DTVDTSKLFRSRSLREFEETLFCHTKSFPISWDTYWDRNDPLRDVDEAAV
PVLCICSADDPVCGPPDHTLPTELFHSNPYFFLLLSRHGGHCGFLRQEPL
PAWSHDVILESFRALTEFFRMEEKMKGLNRRRTSFLGGRRRWGALQKREI
SPSYNLEEIFSWKRSYTRKISLLA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MQPWSAALALFLAALALLLLLVPRLQSPWRRAVGARTLPGALFQDDHKEV
KSRGPADKFSDGREPLPGGCSLICKPSALAQCLLRTLRRSAALEPGPRSW
LSGPHLQTLCHFVLPVGPGPELAREYLQLADDGLVALDWVIGPCPRGRRI
TNTGGLPAVLLVIPNAWGRLTRNVLGLCLLALERGYYPVIFHRRGHHGCP
LVSPRLQPFGDPSDLKEAVTYIRFRHPAAPLFAVSEGSGSALLLSYLGEC
GSSSYVTGAACISPVLRCREWFEAGLPWPYERGFLLHQKIALSRYATALE
DTVDTSKLFRSRSLREFEETLFCHTKSFPISWDTYWDRNDPLRDVDEAAV
PVLCICSADDPVCGPPDHTLPTELFHSNPYFFLLLSRHGGHCGFLRQEPL
PAWSHDVILESFRALTEFFRMEEKMKGLNRRRTSFLGGRRRWGALQKREI
SPSYNLEEIFSWKRSYTRKISLLA



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer