Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: idesa-mheth

Ideonella sakaiensis (strain 201-F6) Mono(2-hydroxyethyl) terephthalate hydrolase MHETase, MHET hydrolase, Mle046, exo-PETase IsMHETase

Comment
Involved in the degradation and assimilation of the plastic poly(ethylene terephthalate) (PET), which allows I.sakaiensis to use PET as its major energy and carbon source for growth. Catalyzes the hydrolysis of mono(2-hydroxyethyl) terephthalate into its two environmentally benign monomers, terephthalate and ethylene glycol. Does not show activity against PET (which is hydrolysed by idesa-peth) (but PET pentamer is a substrate), bis(hydroxyethyl) terephthalate (BHET), pNP-aliphatic esters or typical aromatic ester compounds catalyzed by the tannase family enzymes, such as ethyl gallate and ethyl ferulate. However some mutants of idesa-mheth can hydrolyze BHET ( Palm et al.)


Relationship
Family|Tannase
Block| X
Position in NCBI Life Tree|Ideonella sakaiensis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Betaproteobacteria: N E > Burkholderiales: N E > unclassified Burkholderiales: N E > Burkholderiales Genera incertae sedis: N E > Ideonella: N E > Ideonella sakaiensis: N E


Molecular evidence
Database
No mutation
9 structures (e.g. : 6JTT, 6JTU, 6QG9... more)
No kinetic





5 substrates (e.g. : BHET, BHETA, DMT... more)
4 inhibitors (e.g. : Benzoic-acid, MHET, MHETA... more)
1 Genbank : GAP38911
1 UniProt : A0A0K8P8E7
>3 Structure links 6 more: 6JTU, 6JTT, 6QG9
1 UniProt : A0A0K8P8E7
1 Interpro : A0A0K8P8E7
1 Prodom : A0A0K8P8E7
1 Pfam : A0A0K8P8E7
1 PIRSF : A0A0K8P8E7
1 SUPERFAM : A0A0K8P8E7
Sequence
Graphical view for this peptide sequence: idesa-mheth
Colored MSA for Tannase (raw)
MQTTVTTMLLASVALAACAGGGSTPLPLPQQQPPQQEPPPPPVPLASRAA
CEALKDGNGDMVWPNAATVVEVAAWRDAAPATASAAALPEHCEVSGAIAK
RTGIDGYPYEIKFRLRMPAEWNGRFFMEGGSGTNGSLSAATGSIGGGQIA
SALSRNFATIATDGGHDNAVNDNPDALGTVAFGLDPQARLDMGYNSYDQV
TQAGKAAVARFYGRAADKSYFIGCSEGGREGMMLSQRFPSHYDGIVAGAP
GYQLPKAGISGAWTTQSLAPAAVGLDAQGVPLINKSFSDADLHLLSQAIL
GTCDALDGLADGIVDNYRACQAAFDPATAANPANGQALQCVGAKTADCLS
PVQVTAIKRAMAGPVNSAGTPLYNRWAWDAGMSGLSGTTYNQGWRSWWLG
SFNSSANNAQRVSGFSARSWLVDFATPPEPMPMTQVAARMMKFDFDIDPL
KIWATSGQFTQSSMDWHGATSTDLAAFRDRGGKMILYHGMSDAAFSALDT
ADYYERLGAAMPGAAGFARLFLVPGMNHCSGGPGTDRFDMLTPLVAWVER
GEAPDQISAWSGTPGYFGVAARTRPLCPYPQIARYKGSGDINTEANFACA
APP
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MQTTVTTMLLASVALAACAGGGSTPLPLPQQQPPQQEPPPPPVPLASRAA
CEALKDGNGDMVWPNAATVVEVAAWRDAAPATASAAALPEHCEVSGAIAK
RTGIDGYPYEIKFRLRMPAEWNGRFFMEGGSGTNGSLSAATGSIGGGQIA
SALSRNFATIATDGGHDNAVNDNPDALGTVAFGLDPQARLDMGYNSYDQV
TQAGKAAVARFYGRAADKSYFIGCSEGGREGMMLSQRFPSHYDGIVAGAP
GYQLPKAGISGAWTTQSLAPAAVGLDAQGVPLINKSFSDADLHLLSQAIL
GTCDALDGLADGIVDNYRACQAAFDPATAANPANGQALQCVGAKTADCLS
PVQVTAIKRAMAGPVNSAGTPLYNRWAWDAGMSGLSGTTYNQGWRSWWLG
SFNSSANNAQRVSGFSARSWLVDFATPPEPMPMTQVAARMMKFDFDIDPL
KIWATSGQFTQSSMDWHGATSTDLAAFRDRGGKMILYHGMSDAAFSALDT
ADYYERLGAAMPGAAGFARLFLVPGMNHCSGGPGTDRFDMLTPLVAWVER
GEAPDQISAWSGTPGYFGVAARTRPLCPYPQIARYKGSGDINTEANFACA
APP


References
12 more
    Title: Structural analysis of PET-degrading enzymes PETase and MHETase from Ideonella sakaiensis
    Graf LG, Michels EAP, Yew Y, Liu W, Palm GJ, Weber G
    Ref: Methods Enzymol, 648:337, 2021 : PubMed

            

    Title: Development of a targeted gene disruption system in the PET-degrading bacterium Ideonella sakaiensis and its applications to PETase and MHETase genes
    Hachisuka SI, Nishii T, Yoshida S
    Ref: Applied Environmental Microbiology, :AEM0002021, 2021 : PubMed

            

    Title: IsPETase represents a novel biocatalyst for poly (ethylene terephthalate) (PET) hydrolysis
    Kan Y, He L, Luo Y, Bao R
    Ref: Chembiochem, :, 2021 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer