idesa-peth

 
Ideonella sakaiensis (strain 201-F6) Poly(ethylene terephthalate) hydrolase (plastic degradation), PETase IsPETase

Comment
Polyethylene terephthalate is the most common thermoplastic polymer resin of the polyester family and is used in fibers for clothing, containers for liquids and foods. This enzyme hydrolyses PET in bis(2-hydroxyethyl)-TPA (BHET), MHET (Mono(ethylene terephthalate)), and TPA (Terephthalic-acid)


Relationship
Block L
Ideonella sakaiensis position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Betaproteobacteria: N E > Burkholderiales: N E > unclassified Burkholderiales: N E > Burkholderiales Genera incertae sedis: N E > Ideonella: N E > Ideonella sakaiensis: N E

Molecular evidence
Database
No mutation
30 structures (e.g. : 7QVH, 7CQB, 7SH6... more)
No kinetic

Substrate: Polyethylene-2,5-furandicarboxylate , HEMT , MHET , BHET , Polyethylene-terephthalate ,
Inhibitor: Terephthalic-acid , MHET ,
2 Genbank : WP_054022242, GAP38373
1 UniProt : A0A0K8P6T7
>3 Structure links 27 more: 7QVH, 7CQB, 7SH6
1 UniProtTrembl : A0A0K8P6T7
1 Interpro : A0A0K8P6T7
1 Prodom : A0A0K8P6T7
1 Pfam : A0A0K8P6T7
1 PIRSF : A0A0K8P6T7
1 SUPERFAM : A0A0K8P6T7
1 QuickSwissBlast : A0A0K8P6T7
 
Sequence
Graphical view for this peptide sequence: idesa-peth
Colored MSA for Polyesterase-lipase-cutinase (raw)
MNFPRASRLMQAAVLGGLMAVSAAATAQTNPYARGPNPTAASLEASAGPF
TVRSFTVSRPSGYGAGTVYYPTNAGGTVGAIAIVPGYTARQSSIKWWGPR
LASHGFVVITIDTNSTLDQPSSRSSQQMAALRQVASLNGTSSSPIYGKVD
TARMGVMGWSMGGGGSLISAANNPSLKAAAPQAPWDSSTNFSSVTVPTLI
FACENDSIAPVNSSALPIYDSMSRNAKQFLEINGGSHSCANSGNSNQALI
GKKGVAWMKRFMDNDTRYSTFACENPNSTRVSDFRTANCS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MNFPRASRLMQAAVLGGLMAVSAAATAQTNPYARGPNPTAASLEASAGPF
TVRSFTVSRPSGYGAGTVYYPTNAGGTVGAIAIVPGYTARQSSIKWWGPR
LASHGFVVITIDTNSTLDQPSSRSSQQMAALRQVASLNGTSSSPIYGKVD
TARMGVMGWSMGGGGSLISAANNPSLKAAAPQAPWDSSTNFSSVTVPTLI
FACENDSIAPVNSSALPIYDSMSRNAKQFLEINGGSHSCANSGNSNQALI
GKKGVAWMKRFMDNDTRYSTFACENPNSTRVSDFRTANCS

no DNA




References
32 more
    Title: Enhanced biodegradation of waste poly(ethylene terephthalate) using a reinforced plastic degrading enzyme complex
    Hwang DH, Lee ME, Cho BH, Oh JW, You SK, Ko YJ, Hyeon JE, Han SO
    Ref: Sci Total Environ, :156890, 2022 : PubMed

            

    Title: Directed Evolution of an Efficient and Thermostable PET Depolymerase
    Bell E, Smithson R, Kilbride S, Foster J, Hardy F, Ramachandran S, Tedstone A, Haigh S, Garforth A and Green A <3 more author(s)>
    Ref: Chemrxiv, :, 2021 : PubMed

            

    Title: Deep learning redesign of PETase for practical PET degrading applications
    Lu H, Diaz DJ, Czarnecki NJ, Zhu C, Kim W, Shroff R, Acosta DJ, Alexander B, Cole H and Alper HS <3 more author(s)>
    Ref: Biorxiv, :, 2021 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer