Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: idilo-q5r068

Idiomarina loihiensis acylaminoacyl-peptidase

Relationship
Family|ACPH_Peptidase_S9
Block| X
Position in NCBI Life Tree|Idiomarina loihiensis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Alteromonadales: N E > Idiomarinaceae: N E > Idiomarina: N E > Idiomarina loihiensis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AE017340
1 UniProt : Q5R068
1 UniProt : Q5R068
1 Interpro : Q5R068
1 Prodom : Q5R068
1 Pfam : Q5R068
1 PIRSF : Q5R068
1 SUPERFAM : Q5R068
Sequence
Graphical view for this peptide sequence: idilo-q5r068
Colored MSA for ACPH_Peptidase_S9 (raw)
MKKWIITAAALMLSGTAAAQEKLQLEDIFTLEYASSPTIHPSGEWTVFVR
QSMDINNDRKVGRLWASLPDGDIRPLTGSQGSESQPVWSPSGDRLAYVST
ETGSPQVHIYWVDSGDSAAVTQLTQAPSGLSWSPDGSQIAFSMFTPKSQP
APVSLPGKPEGADWTAAPKYIDKGNYRYDGGGYAKDGHQQIYVIPATGGS
PRQLTDEEFNHGGQLSWSPDSKHIFFSANRRDDAFRQPVNSEIYRLTLST
KEITAITERDGPDGSPKVSPNGEKIAFTGYDDTKMSFQASNLYVMDLDGS
DVELLTGDLDHSVTGFEWDRDSEGVYFTYDNNGVGQLARTDLDGDHTQLT
NRVGGLSYARPYGGGDFSVAKGDRIAFTISNPMRPAELALWDDGDVQQLT
RLNEDALAHKQLAKVEEINYKSSVDGIDLQGWIAYPPGFDKDKDYPLMLE
IHGGPHTNYGPRFAAEIQLFAAAGYVVLYTNPRGSTSYGSDFANEIHHNY
PSHDYNDLMDGVDAVINKGFIDKDELYVTGGSGGGVLTAWIVGHTDRFKA
AVVAKPVINWYSFVLTADMYNFFYQYWFPGLPWENMEHYMKYSPISYVGN
VTTPTMLLTGENDYRTPMSETEQYYQALKLKGVDTAMVRIQDSGHGIYAR
PSNLMNKVAYILHWFEKYRDE
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKKWIITAAALMLSGTAAAQEKLQLEDIFTLEYASSPTIHPSGEWTVFVR
QSMDINNDRKVGRLWASLPDGDIRPLTGSQGSESQPVWSPSGDRLAYVST
ETGSPQVHIYWVDSGDSAAVTQLTQAPSGLSWSPDGSQIAFSMFTPKSQP
APVSLPGKPEGADWTAAPKYIDKGNYRYDGGGYAKDGHQQIYVIPATGGS
PRQLTDEEFNHGGQLSWSPDSKHIFFSANRRDDAFRQPVNSEIYRLTLST
KEITAITERDGPDGSPKVSPNGEKIAFTGYDDTKMSFQASNLYVMDLDGS
DVELLTGDLDHSVTGFEWDRDSEGVYFTYDNNGVGQLARTDLDGDHTQLT
NRVGGLSYARPYGGGDFSVAKGDRIAFTISNPMRPAELALWDDGDVQQLT
RLNEDALAHKQLAKVEEINYKSSVDGIDLQGWIAYPPGFDKDKDYPLMLE
IHGGPHTNYGPRFAAEIQLFAAAGYVVLYTNPRGSTSYGSDFANEIHHNY
PSHDYNDLMDGVDAVINKGFIDKDELYVTGGSGGGVLTAWIVGHTDRFKA
AVVAKPVINWYSFVLTADMYNFFYQYWFPGLPWENMEHYMKYSPISYVGN
VTTPTMLLTGENDYRTPMSETEQYYQALKLKGVDTAMVRIQDSGHGIYAR
PSNLMNKVAYILHWFEKYRDE


Reference
    Title: Genome sequence of the deep-sea gamma-proteobacterium Idiomarina loihiensis reveals amino acid fermentation as a source of carbon and energy
    Hou S, Saw JH, Lee KS, Freitas TA, Belisle C, Kawarabayasi Y, Donachie SP, Pikina A, Galperin MY and Alam M <12 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 101:18036, 2004 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer