Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: isopi-e8qz61

Isosphaera pallida (strain ATCC 43644 / DSM 9630 / IS1B) Peptidase S9B dipeptidylpeptidase IV domain protein

Relationship
Family|DPP4N_Peptidase_S9
Block| X
Position in NCBI Life Tree|Isosphaera pallida
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > PVC group: N E > Planctomycetes: N E > Planctomycetia: N E > Planctomycetales: N E > Isosphaeraceae: N E > Isosphaera: N E > Isosphaera pallida: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : CP002353
1 UniProt : E8QZ61
1 UniProt : E8QZ61
1 Interpro : E8QZ61
1 Prodom : E8QZ61
1 Pfam : E8QZ61
1 PIRSF : E8QZ61
1 SUPERFAM : E8QZ61
Sequence
Graphical view for this peptide sequence: isopi-e8qz61
Colored MSA for DPP4N_Peptidase_S9 (raw)
MSKRVRVRGVTLHGIASRWIGVATATLMLTTGLGIATTPVYAQGTAEDYR
RADQVGQRFNAVAPHLRIEPRWSDDSSRAWYRLDNPDGTREFVLVETAQG
IRRPAFDHERLAHALQDATAATPGAANAKPAQPIDPRRLPIERWSVDAND
LVRFDALGASWVWNPQDEPPLSRSAANPNPESTNPASETGRNGEGRGSRS
QRAHRSNRSPNGLKRVEIRNFNLVLIAQHRSDDAEHDDDDKQLRETEIPL
TTDGTPHDGYRGGIFWSPDSRRFVALRTVEGDSRRVTLVRSSPEDQLQPK
VETYDYLKPGDRVPQTRPRLFDAENGREIPVSTELFDNPWSIDQFLWTGD
SSRFRFSYNQRGHQVMRVVEIQAETGATRAIVEETSPTFIDYAHKQFRHD
LDDHHELIWMSERDGWNHLYLYDTQTARVKAQITRGPWMIRDVVKVDPVR
RLLWLKVLGLHPGQDPYYIHYVRVGFDGTGFMPLTDADGTHEAWFSPDNR
FLIVRHSRVDRAPVIELRDGETGRRIVELERGDLTGLETAGWIAPERFVA
RGRDGVTPIHGVIYRPTTFDPTRAYPVVEQIYAGPHDHHVPKAFAAFHSG
QDLAELGFVVVRIDGMGTNWRGKAFHDVCWRNLKDAGLPDRIAWLKEAAA
RYPQLDLKRVGIYGGSAGGQSALAALLFHGDFYQAAAADCGCHDNRMDKI
WWNELWMGWPVGPHYADNSNVTHAHKLQGHLLLTVGEVDRNVDPASTMQV
VNALIRADKDFDLIVFPNGGHGVGWSAYGRRRLFDFFVRHLHGVEPRRPT
ESSVPTAADTVATFAEPPSRERD
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSKRVRVRGVTLHGIASRWIGVATATLMLTTGLGIATTPVYAQGTAEDYR
RADQVGQRFNAVAPHLRIEPRWSDDSSRAWYRLDNPDGTREFVLVETAQG
IRRPAFDHERLAHALQDATAATPGAANAKPAQPIDPRRLPIERWSVDAND
LVRFDALGASWVWNPQDEPPLSRSAANPNPESTNPASETGRNGEGRGSRS
QRAHRSNRSPNGLKRVEIRNFNLVLIAQHRSDDAEHDDDDKQLRETEIPL
TTDGTPHDGYRGGIFWSPDSRRFVALRTVEGDSRRVTLVRSSPEDQLQPK
VETYDYLKPGDRVPQTRPRLFDAENGREIPVSTELFDNPWSIDQFLWTGD
SSRFRFSYNQRGHQVMRVVEIQAETGATRAIVEETSPTFIDYAHKQFRHD
LDDHHELIWMSERDGWNHLYLYDTQTARVKAQITRGPWMIRDVVKVDPVR
RLLWLKVLGLHPGQDPYYIHYVRVGFDGTGFMPLTDADGTHEAWFSPDNR
FLIVRHSRVDRAPVIELRDGETGRRIVELERGDLTGLETAGWIAPERFVA
RGRDGVTPIHGVIYRPTTFDPTRAYPVVEQIYAGPHDHHVPKAFAAFHSG
QDLAELGFVVVRIDGMGTNWRGKAFHDVCWRNLKDAGLPDRIAWLKEAAA
RYPQLDLKRVGIYGGSAGGQSALAALLFHGDFYQAAAADCGCHDNRMDKI
WWNELWMGWPVGPHYADNSNVTHAHKLQGHLLLTVGEVDRNVDPASTMQV
VNALIRADKDFDLIVFPNGGHGVGWSAYGRRRLFDFFVRHLHGVEPRRPT
ESSVPTAADTVATFAEPPSRERD


Reference
    Title: Complete genome sequence of Isosphaera pallida type strain (IS1B)
    Goker M, Cleland D, Saunders E, Lapidus A, Nolan M, Lucas S, Hammon N, Deshpande S, Cheng JF and Klenk HP <23 more author(s)>
    Ref: Stand Genomic Sci, 4:63, 2011 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer