jansp-Carc

 
Janthinobacterium sp. J3 Carc meta cleavage compound hydrolase

Comment
Inoue,K., Nojiri,H., Nakai,S., Endoh,T., Urata,M., Ashikawa,Y., Saiki,Y., Yoshida,T., Habe,H. and Omori,T


Relationship
Block X
Janthinobacterium sp. J3 position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Betaproteobacteria: N E > Burkholderiales: N E > Oxalobacteraceae: N E > Janthinobacterium: N E > Janthinobacterium sp. J3: N E

Molecular evidence
Database
No mutation
1 structure:
1J1I: Crystal Structure of a Histidine-Tagged Serine Hydrolase Involved in the Carbazole Degradation (Carc Enzyme)
No kinetic



1 Genbank : AB095952
1 Ncbi-nid : 28201193
1 Ncbi-pid : 28201210
1 Structure : 1J1I
1 UniProtTrembl : Q84II3
1 Interpro : Q84II3
1 Prodom : Q84II3
1 Pfam : Q84II3
1 PIRSF : Q84II3
1 SUPERFAM : Q84II3
1 QuickSwissBlast : Q84II3
 
Sequence
Graphical view for this peptide sequence: jansp-Carc
Colored MSA for Carbon-carbon_bond_hydrolase (raw)
MLNKAEQISEKSERAFVERFVNAGGVETRYLEAGKGQPVILIHGGGAGAE
SEGNWRNVIPILARHYRVIAMDMLGFGKTAKPDIEYTQDRRIRHLHDFIK
AMNFDGKVSIVGNSMGGATGLGVSVLHSELVNALVLMGSAGLVVEIHEDL
RPIINYDFTREGMVHLVKALTNDGFKIDDAMINSRYTYATDEATRKAYVA
TMQWIREQGGLFYDPEFIRKVQVPTLVVQGKDDKVVPVETAYKFLDLIDD
SWGYIIPHCGHWAMIEHPEDFANATLSFLSLRVDTTRAAA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MLNKAEQISEKSERAFVERFVNAGGVETRYLEAGKGQPVILIHGGGAGAE
SEGNWRNVIPILARHYRVIAMDMLGFGKTAKPDIEYTQDRRIRHLHDFIK
AMNFDGKVSIVGNSMGGATGLGVSVLHSELVNALVLMGSAGLVVEIHEDL
RPIINYDFTREGMVHLVKALTNDGFKIDDAMINSRYTYATDEATRKAYVA
TMQWIREQGGLFYDPEFIRKVQVPTLVVQGKDDKVVPVETAYKFLDLIDD
SWGYIIPHCGHWAMIEHPEDFANATLSFLSLRVDTTRAAA

Graphical view for this nucleotide DNA sequence (903 bp): jansp-Carc
>jansp-Carc
atgttaaataaagctgaacaaatctcggaaaagtccgaacgtgcgtttgt
cgaacgctttgttaatgcgggcggtgtggaaacccgctatcttgaagccg
gcaaaggtcagcccgtcatcttgatccacggagggggtgcaggagcagag
agcgaaggtaattggagaaacgttattccgattcttgctcgtcactatcg
tgtgattgctatggacatgcttggtttcggtaagactgcaaagcctgata
tcgaatatacgcaggaccgacgcattcgtcacttgcacgattttattaag
gcgatgaacttcgacggcaaggtctcgatcgtgggaaattcgatgggtgg
cgcgaccggcctcggtgtgtctgttcttcactctgaactcgtcaatgcac
tggtgcttatgggaagtgcaggcctcgtagtcgaaatccacgaggatctg
cgccctatcatcaactacgatttcacacgtgagggtatggtccacttggt
taaggcacttaccaacgatggattcaagatcgacgatgcgatgattaact
cgcgctatacctatgcgaccgatgaagctactcgcaaagcctatgtggca
acaatgcagtggattcgcgaacagggcggacttttctacgatcccgagtt
catccgaaaagtgcaggtgccgaccctcgtggtgcaagggaaagacgaca
aggtcgttccagttgaaactgcatacaagtttcttgatctcatcgatgac
agctggggctacattatcccgcactgcggccactgggcgatgatcgaaca
tccagaggactttgcgaacgcaactctgtcgttcctctctctccgtgtag
atactacccgtgctgcagcataa



Reference
    Title: Crystal structure of a histidine-tagged serine hydrolase involved in the carbazole degradation (CarC enzyme)
    Habe H, Morii K, Fushinobu S, Nam JW, Ayabe Y, Yoshida T, Wakagi T, Yamane H, Nojiri H, Omori T
    Ref: Biochemical & Biophysical Research Communications, 303:631, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer