(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) > cellular organisms: NE > Bacteria: NE > Proteobacteria: NE > Gammaproteobacteria: NE > Oceanospirillales: NE > Kangiellaceae: NE > Kangiella: NE > Kangiella koreensis: NE
LegendThis sequence has been compared to family alignement (MSA) red => minority aminoacid blue => majority aminoacid color intensity => conservation rate title => sequence position(MSA position)aminoacid rate Catalytic site Catalytic site in the MSA MKIILLPGVDGTGILFEPFVNTFKADVPVEVMPLTEDSDQSILNQVSIIE QAVGDEEIILIVESYSGLLAYELAKRNKIRIKQIFFFGCFLQPPSFIGKI GRFLPVRLLNVIPDKLLSRILFNRWSSPELIALFHKAVASVDFPNLKKRL KTIATHQKPTQLIDVPCVYVQGTMDNLVSAYNLKAFEELCSSLQVEVVEA THMLLQTQPETMSQLIHKYLQL
Kangiella koreensis (Yoon et al. 2004) is the type species of the genus and is of phylogenetic interest because of the very isolated location of the genus Kangiella in the gammaproteobacterial order Oceanospirillales. K. koreensis SW-125(T) is a Gram-negative, non-motile, non-spore-forming bacterium isolated from tidal flat sediments at Daepo Beach, Yellow Sea, Korea. Here we describe the features of this organism, together with the complete genome sequence, and annotation. This is the first completed genome sequence from the genus Kangiella and only the fourth genome from the order Oceanospirillales. This 2,852,073 bp long single replicon genome with its 2647 protein-coding and 48 RNA genes is part of the Genomic Encyclopedia of Bacteria and Archaea project.