Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: klep7-mhpc

Klebsiella pneumoniae subsp. pneumoniae 2-hydroxy-6-oxonona-2,4-diene-1,9-dioic acid 5,6-hydrolase

Comment
Other strains: Klebsiella pneumoniae subsp. pneumoniae (strains ATCC 700721 / MG78578; NTUH-K2044; 2N3; HS11286)subsp. rhinoscleromatis (strain ATCC 13884) Klebsiella pneumoniae (strain 342) Klebsiella variicola (strain At-22). GNSMG replaced by GHLMGG in some strains


Relationship
Family|Carbon-carbon_bond_hydrolase
Block| X
Position in NCBI Life Tree|Klebsiella pneumoniae subsp. pneumoniae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Enterobacterales: N E > Enterobacteriaceae: N E > Klebsiella: N E > Klebsiella pneumoniae: N E > Klebsiella pneumoniae subsp. pneumoniae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: klep7-mhpc
Colored MSA for Carbon-carbon_bond_hydrolase (raw)
MSYQPQTEAATSRFLNVDEGGRTLRIHINDCGDGKETVVMLHGSGPGATG
WANFSRNIDPLVEAGYRVLLLDCPGWGKSDAIVNSGSRSDLNARILKSVV
DQLGIDKVHLLGNSMGGHSAVAFTLSWPERVAKLVLMGGGTGGMSLFTPM
PTEGIKLLNALYREPTIENLKKMMSIFVFDTRDLTEALFEARLNNMLSRR
DHLDNFVKSLEANPKQFPDFGPRLGEISAPTLIVWGRNDRFVPMDAGLRL
LAGIAGSELHIYRDCGHWAQWEHADSFNQLVLNFLARA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSYQPQTEAATSRFLNVDEGGRTLRIHINDCGDGKETVVMLHGSGPGATG
WANFSRNIDPLVEAGYRVLLLDCPGWGKSDAIVNSGSRSDLNARILKSVV
DQLGIDKVHLLGNSMGGHSAVAFTLSWPERVAKLVLMGGGTGGMSLFTPM
PTEGIKLLNALYREPTIENLKKMMSIFVFDTRDLTEALFEARLNNMLSRR
DHLDNFVKSLEANPKQFPDFGPRLGEISAPTLIVWGRNDRFVPMDAGLRL
LAGIAGSELHIYRDCGHWAQWEHADSFNQLVLNFLARA


References
    Title: Whole Genome Sequencing and Analysis of Chlorimuron-Ethyl Degrading Bacteria Klebsiella pneumoniae 2N3
    Zhang C, Hao Q, Zhang Z, Zhang X, Pan H, Zhang J, Zhang H, Sun F
    Ref: Int J Mol Sci, 20:, 2019 : PubMed

            

    Title: Genome sequencing and comparative analysis of Klebsiella pneumoniae NTUH-K2044, a strain causing liver abscess and meningitis
    Wu KM, Li LH, Yan JJ, Tsao N, Liao TL, Tsai HC, Fung CP, Chen HJ, Liu YM and Tsai SF <10 more author(s)>
    Ref: Journal of Bacteriology, 191:4492, 2009 : PubMed

            

    Title: Complete genome sequence of the N2-fixing broad host range endophyte Klebsiella pneumoniae 342 and virulence predictions verified in mice
    Fouts DE, Tyler HL, DeBoy RT, Daugherty S, Ren Q, Badger JH, Durkin AS, Huot H, Shrivastava S and Methe BA <8 more author(s)>
    Ref: PLoS Genet, 4:e1000141, 2008 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer