Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: kompc-f2qms6

Komagataella phaffii (strain ATCC 76273 / CBS 7435 / CECT 11047 / NRRL Y-11430 / Wegner 21-1) (Yeast) (Pichia pastoris) Acyl-coenzymeA:ethanol O-acyltransferase

Relationship
Family|abh_upf0017
Block| X
Position in NCBI Life Tree|Komagataella phaffii CBS 7435
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Saccharomycotina: N E > Saccharomycetes: N E > Saccharomycetales: N E > Phaffomycetaceae: N E > Komagataella: N E > Komagataella phaffii: N E > Komagataella phaffii CBS 7435: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : CCA36881
1 UniProt : F2QMS6
1 UniProt : F2QMS6
1 Interpro : F2QMS6
1 Pfam : F2QMS6
1 PIRSF : F2QMS6
1 SUPERFAM : F2QMS6
Sequence
Graphical view for this peptide sequence: kompc-f2qms6
Colored MSA for abh_upf0017 (raw)
MPSWGFHNQIHATYSDKSVALKLKSGKNDFAPLNVIPFSTFIKTLVPELS
DGYKFNLHPFLFNGALQTLYASKADYSKEFQIYYGRCMVRYPEANHEYPH
LHLGQATADFVVDPPTEIDEWNYLYNQTLPEGWPRLHPRTRFLTVQEEQD
LEADWASNSGSIVVIIHGLAGGSHEPGIRDVSQHLHQAGFNVVTLNSRGC
CRSKLSTGRLYSAVETDDLRYFIDELHKKIPNKPIYLLGFSLGSALVLNY
LGEEGKKSFIKSAVTIGAPVDLLDSHYHLNHSYSGKYLFDPAVASFLSNL
VKVNFPILNRDKPEVFSYEKKSKDYLVRRIVDFDRKYTAPAYGFASPKYY
YQAGSPLTKLVNIYTPTVLLNSLDDPVVSCNLPVDEVKANPYLYLAASDL
GGHLAYIQWDGGFWFSEAVSAYFMAFESELSNEPAQSDYEPQLSEYSYKT
GI
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MPSWGFHNQIHATYSDKSVALKLKSGKNDFAPLNVIPFSTFIKTLVPELS
DGYKFNLHPFLFNGALQTLYASKADYSKEFQIYYGRCMVRYPEANHEYPH
LHLGQATADFVVDPPTEIDEWNYLYNQTLPEGWPRLHPRTRFLTVQEEQD
LEADWASNSGSIVVIIHGLAGGSHEPGIRDVSQHLHQAGFNVVTLNSRGC
CRSKLSTGRLYSAVETDDLRYFIDELHKKIPNKPIYLLGFSLGSALVLNY
LGEEGKKSFIKSAVTIGAPVDLLDSHYHLNHSYSGKYLFDPAVASFLSNL
VKVNFPILNRDKPEVFSYEKKSKDYLVRRIVDFDRKYTAPAYGFASPKYY
YQAGSPLTKLVNIYTPTVLLNSLDDPVVSCNLPVDEVKANPYLYLAASDL
GGHLAYIQWDGGFWFSEAVSAYFMAFESELSNEPAQSDYEPQLSEYSYKT
GI


Reference
    Title: Ester-Producing Mechanism of Ethanol O-acyltransferase EHT1 Gene in Pichia pastoris from Shanxi Aged Vinegar
    Chen J, Nan R, Wang R, Zhang L, Shi J
    Ref: Biomed Res Int, 2019:4862647, 2019 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer