Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: lacda-q1g8l1

Lactobacillu s delbrueckii Prolyl aminopeptidase

Comment
Other strains: Lactobacillus delbrueckii (strains: ZN7a-9; subsp. bulgaricus (strains ATCC 11842 / DSM 20081; ATCC BAA-365; PB2003/044-T3-4; ND02; 2038; CNCM I-1632; CNCM I-1519) subsp. lactis (DSM 20072; CRL581)


Relationship
Family|Proline_iminopeptidase
Block| X
Position in NCBI Life Tree|Lactobacillus delbrueckii subsp. bulgaricus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Lactobacillales: N E > Lactobacillaceae: N E > Lactobacillus: N E > Lactobacillus delbrueckii: N E > Lactobacillus delbrueckii subsp. bulgaricus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 7 more: CR954253, CP000412, ATBQ01000207
>3 UniProt links 1 more: Q1G8L1, G6F729, F0K046
>3 UniProt links 1 more: Q1G8L1, G6F729, F0K046
>3 Interpro links 1 more: Q1G8L1, G6F729, F0K046
>3 Prodom links 1 more: Q1G8L1, G6F729, F0K046
>3 Pfam links 1 more: Q1G8L1, G6F729, F0K046
>3 PIRSF links 1 more: Q1G8L1, G6F729, F0K046
>3 SUPERFAM links 1 more: Q1G8L1, G6F729, F0K046
Sequence
Graphical view for this peptide sequence: lacda-q1g8l1
Colored MSA for Proline_iminopeptidase (raw)
MKQGTTILTLDNGYHLWTNTQGTGDIHLLCLHGGPGGNHEYWEDTAEQLK
KQGLNVQVHMYDQLGSLYSDQPDYSDPKIADKYLTYEYFLDEVEEVRQKL
GIDNFYLIGQSWGGLLVQEYAVKYGDHLKGAIISSMVDDIDEYVAAVNRR
RQEVLPQTEIDFMHECEAKNDYANQRYQDDVQILNINFVDRKQPSKLYHL
GNLGGTAVYNAFQGDNEFVITGKLKDWHFRSELPKIKVPTLLTFGEVETM
PLETARTMQKLIPNSRLVTTPDGGHHHMVDNPDVYYKHLADFIREVEAGT
FQGE
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKQGTTILTLDNGYHLWTNTQGTGDIHLLCLHGGPGGNHEYWEDTAEQLK
KQGLNVQVHMYDQLGSLYSDQPDYSDPKIADKYLTYEYFLDEVEEVRQKL
GIDNFYLIGQSWGGLLVQEYAVKYGDHLKGAIISSMVDDIDEYVAAVNRR
RQEVLPQTEIDFMHECEAKNDYANQRYQDDVQILNINFVDRKQPSKLYHL
GNLGGTAVYNAFQGDNEFVITGKLKDWHFRSELPKIKVPTLLTFGEVETM
PLETARTMQKLIPNSRLVTTPDGGHHHMVDNPDVYYKHLADFIREVEAGT
FQGE


References
2 more
    Title: Genome Sequence of the Cheese-Starter Strain Lactobacillus delbrueckii subsp. lactis CRL 581
    Hebert EM, Raya RR, Brown L, Font de Valdez G, Savoy de Giori G, Taranto MP
    Ref: Genome Announc, 1:e00602, 2013 : PubMed

            

    Title: Complete sequencing and pan-genomic analysis of Lactobacillus delbrueckii subsp. bulgaricus reveal its genetic basis for industrial yogurt production
    Hao P, Zheng H, Yu Y, Ding G, Gu W, Chen S, Yu Z, Ren S, Oda M and Zhao G <4 more author(s)>
    Ref: PLoS ONE, 6:e15964, 2011 : PubMed

            

    Title: The impact of a consortium of fermented milk strains on the gut microbiome of gnotobiotic mice and monozygotic twins
    McNulty NP, Yatsunenko T, Hsiao A, Faith JJ, Muegge BD, Goodman AL, Henrissat B, Oozeer R, Cools-Portier S and Gordon JI <10 more author(s)>
    Ref: Sci Transl Med, 3:106ra106, 2011 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer