Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: lacdb-q04ci8

Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 strain ATCC 11842 / DS20081) alpha/beta superfamily hydrolase

Relationship
Family|6_AlphaBeta_hydrolase
Block| X
Position in NCBI Life Tree|Lactobacillus delbrueckii subsp. bulgaricus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Lactobacillales: N E > Lactobacillaceae: N E > Lactobacillus: N E > Lactobacillus delbrueckii: N E > Lactobacillus delbrueckii subsp. bulgaricus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : CP000412, CR954253
1 UniProt : Q1G7R1
1 UniProt : Q1G7R1
1 Interpro : Q1G7R1
1 Prodom : Q1G7R1
1 Pfam : Q1G7R1
1 PIRSF : Q1G7R1
1 SUPERFAM : Q1G7R1
Sequence
Graphical view for this peptide sequence: lacdb-q04ci8
Colored MSA for 6_AlphaBeta_hydrolase (raw)
MIIKVNGVDLYYQKLGQGQPLILLHGHHLDGGMYSKVIAPLSLYYTVYTL
DMRGHGLSGGDGAEHYQTEVEDLAVFIKELGLEQPYVFGYDSGGLVTLML
ASQQPDILGKAVVAGVFIDGRGIHKYHYLTEGVRRFLRFDRDSRVELTES
YMEPESLEQIKIPVLCVVGENDWVKVEHVRWYSSLIPNGRLALMPRQTHD
SYVVDSLKILDLIKDFCKE
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MIIKVNGVDLYYQKLGQGQPLILLHGHHLDGGMYSKVIAPLSLYYTVYTL
DMRGHGLSGGDGAEHYQTEVEDLAVFIKELGLEQPYVFGYDSGGLVTLML
ASQQPDILGKAVVAGVFIDGRGIHKYHYLTEGVRRFLRFDRDSRVELTES
YMEPESLEQIKIPVLCVVGENDWVKVEHVRWYSSLIPNGRLALMPRQTHD
SYVVDSLKILDLIKDFCKE


References
    Title: Comparative genomics of the lactic acid bacteria
    Makarova K, Slesarev A, Wolf Y, Sorokin A, Mirkin B, Koonin E, Pavlov A, Pavlova N, Karamychev V and Mills D <40 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 103:15611, 2006 : PubMed

            

    Title: The complete genome sequence of Lactobacillus bulgaricus reveals extensive and ongoing reductive evolution
    van de Guchte M, Penaud S, Grimaldi C, Barbe V, Bryson K, Nicolas P, Robert C, Oztas S, Mangenot S and Maguin E <11 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 103:9274, 2006 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer