Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: lacjo-q74hk5

Lactobacillus johnsonii NCC 533 Hydrolase_4 domain-containing protein cinnamoyl esterase

Relationship
Family|AlphaBeta_hydrolase
Block| X
Position in NCBI Life Tree|Lactobacillus johnsonii NCC 533
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Lactobacillales: N E > Lactobacillaceae: N E > Lactobacillus: N E > Lactobacillus johnsonii: N E > Lactobacillus johnsonii NCC 533: N E


Molecular evidence
Database
No mutation
6 structures (e.g. : 3PF8, 3PF9, 3PFB... more)
No kinetic





5 substrates (e.g. : 1-Naphtylacetate, 1-Naphtylbutyrate, 1-Naphtylpropionate... more)
1 inhbitor:
Caffeic-acid
1 Genbank : AE017206
1 UniProt : Q74HK5
>3 Structure links 3 more: 3PF8, 3PF9, 3PFB
1 UniProt : Q74HK5
1 Interpro : Q74HK5
1 Prodom : Q74HK5
1 Pfam : Q74HK5
1 PIRSF : Q74HK5
1 SUPERFAM : Q74HK5
Sequence
Graphical view for this peptide sequence: lacjo-q74hk5
Colored MSA for AlphaBeta_hydrolase (raw)
MATITLERDGLQLVGTREEPFGEIYDMAIIFHGFTANRNTSLLKEIANSL
RDENIASVRFDFNGHGDSDGKFENMTVLNEIEDANAILNYVKTDPHVRNI
YLVGHSQGGVVASMLAGLYPDLIKKVVLLAPAATLKSDALEGNTQGVTYN
PDHIPDRLPFKDLTLGGFYLRIAQQLPIYEVSAQFTKPVCLIHGTDDTVV
SPNASKKYDQIYQNSTLHLIEGADHCFSDSYQKNAVNLTTDFLQNNNAF
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MATITLERDGLQLVGTREEPFGEIYDMAIIFHGFTANRNTSLLKEIANSL
RDENIASVRFDFNGHGDSDGKFENMTVLNEIEDANAILNYVKTDPHVRNI
YLVGHSQGGVVASMLAGLYPDLIKKVVLLAPAATLKSDALEGNTQGVTYN
PDHIPDRLPFKDLTLGGFYLRIAQQLPIYEVSAQFTKPVCLIHGTDDTVV
SPNASKKYDQIYQNSTLHLIEGADHCFSDSYQKNAVNLTTDFLQNNNAF


References
1 more
    Title: An inserted alpha/beta subdomain shapes the catalytic pocket of Lactobacillus johnsonii cinnamoyl esterase
    Lai KK, Stogios PJ, Vu C, Xu X, Cui H, Molloy S, Savchenko A, Yakunin A, Gonzalez CF
    Ref: PLoS ONE, 6:e23269, 2011 : PubMed

            

    Title: Biochemical properties of two cinnamoyl esterases purified from a Lactobacillus johnsonii strain isolated from stool samples of diabetes-resistant rats
    Lai KK, Lorca GL, Gonzalez CF
    Ref: Applied Environmental Microbiology, 75:5018, 2009 : PubMed

            

    Title: L-alanine auxotrophy of Lactobacillus johnsonii as demonstrated by physiological, genomic, and gene complementation approaches
    van der Kaaij H, Desiere F, Mollet B, Germond JE
    Ref: Applied Environmental Microbiology, 70:1869, 2004 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer