Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: lacla-YAHD

Lactococcus lactis (subsp. lactis) (Streptococcus lactis) hypothetical protein yahd

Comment
previously 6_AlphaBeta_hydrolase


Relationship
Family|LYsophospholipase_carboxylesterase
Block| X
Position in NCBI Life Tree|Lactococcus lactis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Lactobacillales: N E > Streptococcaceae: N E > Lactococcus: N E > Lactococcus lactis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
1 structure:
3OG9: Structure of YahD with Malic acid
No kinetic





No Substrate
No inhibitor
1 Genbank : AE006246
1 Structure : 3OG9
1 UniProt : Q9CJC1
1 Interpro : Q9CJC1
1 Prodom : Q9CJC1
1 Pfam : Q9CJC1
1 PIRSF : Q9CJC1
1 SUPERFAM : Q9CJC1
Sequence
Graphical view for this peptide sequence: lacla-YAHD
Colored MSA for LYsophospholipase_carboxylesterase (raw)
MTDYVFKAGRKDLAPLLLLHSTGGDEHQLVEIAEMIAPSHPILSIRGRIN
EQGVNRYFKLRGLGGFTKENFDLESLDEETDWLTDEVSLLAEKHDLDVHK
MIAIGYSNGANVALNMFLRGKINFDKIIAFHGMQLEDFEQTVQLDDKHVF
LSYAPNDMIVPQKNFGDLKGDLEDSGCQLEIYESSLGHQLMQEEVLAANK
WLTETK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTDYVFKAGRKDLAPLLLLHSTGGDEHQLVEIAEMIAPSHPILSIRGRIN
EQGVNRYFKLRGLGGFTKENFDLESLDEETDWLTDEVSLLAEKHDLDVHK
MIAIGYSNGANVALNMFLRGKINFDKIIAFHGMQLEDFEQTVQLDDKHVF
LSYAPNDMIVPQKNFGDLKGDLEDSGCQLEIYESSLGHQLMQEEVLAANK
WLTETK


References
    Title: Regulation and structure of YahD, a copper-inducible alpha/beta serine hydrolase of Lactococcus lactis IL1403
    Martinez J, Mancini S, Tauberger E, Weise C, Saenger W, Solioz M
    Ref: FEMS Microbiology Letters, 314:57, 2011 : PubMed

            

    Title: The complete genome sequence of the lactic acid bacterium Lactococcus lactis ssp. lactis IL1403
    Bolotin A, Wincker P, Mauger S, Jaillon O, Malarme K, Weissenbach J, Ehrlich SD, Sorokin A
    Ref: Genome Res, 11:731, 2001 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer