Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: lacla-YQBF

Lactococcus lactis (subsp. lactis) (Streptococcus lactis) hypothetical protein yqbf

Relationship
Family|AlphaBeta_hydrolase
Block| X
Position in NCBI Life Tree|Lactococcus lactis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Lactobacillales: N E > Streptococcaceae: N E > Lactococcus: N E > Lactococcus lactis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 7 more: AE006388, WP_003130718, WP_021722714
>3 UniProt links 15 more: Q9CFA7, G6FC57, H5T081
>3 Interpro links 15 more: Q9CFA7, G6FC57, H5T081
>3 Prodom links 15 more: Q9CFA7, G6FC57, H5T081
>3 Pfam links 15 more: Q9CFA7, G6FC57, H5T081
>3 PIRSF links 15 more: Q9CFA7, G6FC57, H5T081
>3 SUPERFAM links 15 more: Q9CFA7, G6FC57, H5T081
Sequence
Graphical view for this peptide sequence: lacla-YQBF
Colored MSA for AlphaBeta_hydrolase (raw)
MKKRKKMIAWILVVLSVVLVGGYFAIGNYFYDLAVNAHTNKSFLTAGSKQ
KPLSKKEEERKKENKAFLADVKSDAWYVTSSDKLKLKLYAADYKQPTKTN
KWAIVVHGYGGQSIDMASWTRHFYNKGYNVVTPDLRGHGKSQGDYIGMGW
DDRKDMLLWIAKIIQKGPQAEIVLLGVSMGGATVMNTSGEKLPSNVKAIV
EDCGFTSTVDVFAYQLKQLYGLPKFPVLYAANTVVKMRAGYDIFKSSAIK
QVAKSKTPILFIHGDKDTFVPFKMLNPLYDAAKVEKEKLIVHGAGHGESE
KVNPDLYWSHVWDFVGKYMS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKKRKKMIAWILVVLSVVLVGGYFAIGNYFYDLAVNAHTNKSFLTAGSKQ
KPLSKKEEERKKENKAFLADVKSDAWYVTSSDKLKLKLYAADYKQPTKTN
KWAIVVHGYGGQSIDMASWTRHFYNKGYNVVTPDLRGHGKSQGDYIGMGW
DDRKDMLLWIAKIIQKGPQAEIVLLGVSMGGATVMNTSGEKLPSNVKAIV
EDCGFTSTVDVFAYQLKQLYGLPKFPVLYAANTVVKMRAGYDIFKSSAIK
QVAKSKTPILFIHGDKDTFVPFKMLNPLYDAAKVEKEKLIVHGAGHGESE
KVNPDLYWSHVWDFVGKYMS


Reference
    Title: The complete genome sequence of the lactic acid bacterium Lactococcus lactis ssp. lactis IL1403
    Bolotin A, Wincker P, Mauger S, Jaillon O, Malarme K, Weissenbach J, Ehrlich SD, Sorokin A
    Ref: Genome Res, 11:731, 2001 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer