Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: lacrh-B2CZF3

Lactobacillus rhamnosus esterase D

Comment
Other strains: Lactobacillus rhamnosus (and strains LMS2-1; ATCC 53103 / GG; MTCC 5462; LRHMDP2; LOCK908) Bennett M.D., Delabre M.-L., Holland R., Norris G.E. Snapshots of esterase D from Lactobacillus rhamnosus: Insights into a novel rotation driven catalytic mechanism


Relationship
Family|CarbLipBact_1
Block| X
Position in NCBI Life Tree|Lactobacillus rhamnosus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Lactobacillales: N E > Lactobacillaceae: N E > Lactobacillus: N E > Lactobacillus rhamnosus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
5 structures (e.g. : 3DKR, 3DLT, 3DYI... more)
No kinetic





No Substrate
1 inhbitor:
Paraoxon
>3 Genbank links 6 more: ACB47388, ACIZ01000047, AP011548
>3 UniProt links 1 more: B2CZF3, C2JVW0, F3MZ06
>3 Structure links 2 more: 3E1G, 3DYI, 3DYV
>3 UniProt links 1 more: B2CZF3, C2JVW0, F3MZ06
>3 Interpro links 1 more: B2CZF3, C2JVW0, F3MZ06
>3 Prodom links 1 more: B2CZF3, C2JVW0, F3MZ06
>3 Pfam links 1 more: B2CZF3, C2JVW0, F3MZ06
>3 PIRSF links 1 more: B2CZF3, C2JVW0, F3MZ06
>3 SUPERFAM links 1 more: B2CZF3, C2JVW0, F3MZ06
Sequence
Graphical view for this peptide sequence: lacrh-B2CZF3
Colored MSA for CarbLipBact_1 (raw)
MIFRKPQPFEYEGTDTGVVLLHAYTGSPNDMNFMARALQRSGYGVYVPLF
SGHGTVEPLDILTKGNPDIWWAESSAAVAHMTAKYAKVFVFGLSLGGIFA
MKALETLPGITAGGVFSSPILPGKHHLVPGFLKYAEYMNRLAGKSDESTQ
ILAYLPGQLAAIDQFATTVAADLNLVKQPTFIGQAGQDELVDGRLAYQLR
DALINAARVDFHWYDDAKHVITVNSAHHALEEDVIAFMQQENEG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MIFRKPQPFEYEGTDTGVVLLHAYTGSPNDMNFMARALQRSGYGVYVPLF
SGHGTVEPLDILTKGNPDIWWAESSAAVAHMTAKYAKVFVFGLSLGGIFA
MKALETLPGITAGGVFSSPILPGKHHLVPGFLKYAEYMNRLAGKSDESTQ
ILAYLPGQLAAIDQFATTVAADLNLVKQPTFIGQAGQDELVDGRLAYQLR
DALINAARVDFHWYDDAKHVITVNSAHHALEEDVIAFMQQENEG


References
1 more
    Title: Draft Genome Sequences of Two Clinical Isolates of Lactobacillus rhamnosus from Initial Stages of Dental Pulp Infection
    Chen Z, Wilkins MR, Hunter N, Nadkarni MA
    Ref: Genome Announc, 1:, 2013 : PubMed

            

    Title: Comparative genomic analysis of Lactobacillus rhamnosus GG reveals pili containing a human- mucus binding protein
    Kankainen M, Paulin L, Tynkkynen S, von Ossowski I, Reunanen J, Partanen P, Satokari R, Vesterlund S, Hendrickx AP and de Vos WM <20 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 106:17193, 2009 : PubMed

            

    Title: Complete genome sequence of the probiotic Lactobacillus rhamnosus ATCC 53103
    Morita H, Toh H, Oshima K, Murakami M, Taylor TD, Igimi S, Hattori M
    Ref: Journal of Bacteriology, 191:7630, 2009 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer