Other strains: Lactobacillus rhamnosus (and strains LMS2-1; ATCC 53103 / GG; MTCC 5462; LRHMDP2; LOCK908) Bennett M.D., Delabre M.-L., Holland R., Norris G.E. Snapshots of esterase D from Lactobacillus rhamnosus: Insights into a novel rotation driven catalytic mechanism
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) > cellular organisms: NE > Bacteria: NE > Terrabacteria group: NE > Firmicutes: NE > Bacilli: NE > Lactobacillales: NE > Lactobacillaceae: NE > Lactobacillus: NE > Lactobacillus rhamnosus: NE
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) Lactobacillus rhamnosus LMS2-1: N, E.
Lactobacillus rhamnosus GG: N, E.
Lactobacillus rhamnosus HN001: N, E.
Lactobacillus rhamnosus Lc 705: N, E.
Lactobacillus rhamnosus ATCC 8530: N, E.
Lactobacillus rhamnosus LRHMDP3: N, E.
Lactobacillus rhamnosus ATCC 21052: N, E.
Lactobacillus rhamnosus LOCK900: N, E.
Lactobacillus rhamnosus MTCC 5462: N, E.
Lactobacillus rhamnosus LRHMDP2: N, E.
Lactobacillus rhamnosus R0011: N, E.
Lactobacillus rhamnosus LOCK908: N, E.
Lactobacillus rhamnosus 2166: N, E.
Molecular evidence
Database
No mutation 5 structures(e.g. : 3DKR, 3DLT, 3DYI... more)(less) 3DKR: Snapshots of esterase D from lactobacillus rhamnosus: Insights into a rotation driven catalytic mechanism 1, 3DLT: Snapshots of esterase D from lactobacillus rhamnosus: Insights into a rotation driven catalytic mechanism 2, 3DYI: Snapshots of esterase D from lactobacillus rhamnosus: Insights into a rotation driven catalytic mechanism 3, 3DYV: Snapshots of esterase D from lactobacillus rhamnosus: Insights into a rotation driven catalytic mechanism 4, 3E1G: Snapshots of esterase D from lactobacillus rhamnosus: Insights into a rotation driven catalytic mechanism No kinetic
LegendThis sequence has been compared to family alignement (MSA) red => minority aminoacid blue => majority aminoacid color intensity => conservation rate title => sequence position(MSA position)aminoacid rate Catalytic site Catalytic site in the MSA MIFRKPQPFEYEGTDTGVVLLHAYTGSPNDMNFMARALQRSGYGVYVPLF SGHGTVEPLDILTKGNPDIWWAESSAAVAHMTAKYAKVFVFGLSLGGIFA MKALETLPGITAGGVFSSPILPGKHHLVPGFLKYAEYMNRLAGKSDESTQ ILAYLPGQLAAIDQFATTVAADLNLVKQPTFIGQAGQDELVDGRLAYQLR DALINAARVDFHWYDDAKHVITVNSAHHALEEDVIAFMQQENEG
References
1 moreTitle: Draft Genome Sequences of Two Clinical Isolates of Lactobacillus rhamnosus from Initial Stages of Dental Pulp Infection Chen Z, Wilkins MR, Hunter N, Nadkarni MA Ref: Genome Announc, 1:, 2013 : PubMed
Here we report the draft genomic sequences of two clinical isolates of Lactobacillus rhamnosus from infected dental pulps representing the initial stages of infection of pulp tissue. Based on 454 FLX+ pyrosequencing, the two clinical isolates infecting vital pulp had a genome length of 2.9 Mbp with distinct genomic signatures.
To unravel the biological function of the widely used probiotic bacterium Lactobacillus rhamnosus GG, we compared its 3.0-Mbp genome sequence with the similarly sized genome of L. rhamnosus LC705, an adjunct starter culture exhibiting reduced binding to mucus. Both genomes demonstrated high sequence identity and synteny. However, for both strains, genomic islands, 5 in GG and 4 in LC705, punctuated the colinearity. A significant number of strain-specific genes were predicted in these islands (80 in GG and 72 in LC705). The GG-specific islands included genes coding for bacteriophage components, sugar metabolism and transport, and exopolysaccharide biosynthesis. One island only found in L. rhamnosus GG contained genes for 3 secreted LPXTG-like pilins (spaCBA) and a pilin-dedicated sortase. Using anti-SpaC antibodies, the physical presence of cell wall-bound pili was confirmed by immunoblotting. Immunogold electron microscopy showed that the SpaC pilin is located at the pilus tip but also sporadically throughout the structure. Moreover, the adherence of strain GG to human intestinal mucus was blocked by SpaC antiserum and abolished in a mutant carrying an inactivated spaC gene. Similarly, binding to mucus was demonstrated for the purified SpaC protein. We conclude that the presence of SpaC is essential for the mucus interaction of L. rhamnosus GG and likely explains its ability to persist in the human intestinal tract longer than LC705 during an intervention trial. The presence of mucus-binding pili on the surface of a nonpathogenic Gram-positive bacterial strain reveals a previously undescribed mechanism for the interaction of selected probiotic lactobacilli with host tissues.
Lactobacillus rhamnosus is a facultatively heterofermentative lactic acid bacterium and is frequently isolated from human gastrointestinal mucosa of healthy individuals. L. rhamnosus ATCC 53103, isolated from a healthy human intestinal flora, is one of the most widely used and well-documented probiotics. Here, we report the finished and annotated genome sequence of this organism.
Lactobacillus rhamnosus LOCK908, a patented probiotic strain (Polish patent no. 209987), was isolated from the feces of a healthy 6-year-old girl. Here, we present the complete genome sequence of LOCK908 and identify genes likely to be involved in the biosynthesis of exopolysaccharides (EPSs).
Title: Draft Genome Sequences of Two Clinical Isolates of Lactobacillus rhamnosus from Initial Stages of Dental Pulp Infection Chen Z, Wilkins MR, Hunter N, Nadkarni MA Ref: Genome Announc, 1:, 2013 : PubMed
Here we report the draft genomic sequences of two clinical isolates of Lactobacillus rhamnosus from infected dental pulps representing the initial stages of infection of pulp tissue. Based on 454 FLX+ pyrosequencing, the two clinical isolates infecting vital pulp had a genome length of 2.9 Mbp with distinct genomic signatures.
To unravel the biological function of the widely used probiotic bacterium Lactobacillus rhamnosus GG, we compared its 3.0-Mbp genome sequence with the similarly sized genome of L. rhamnosus LC705, an adjunct starter culture exhibiting reduced binding to mucus. Both genomes demonstrated high sequence identity and synteny. However, for both strains, genomic islands, 5 in GG and 4 in LC705, punctuated the colinearity. A significant number of strain-specific genes were predicted in these islands (80 in GG and 72 in LC705). The GG-specific islands included genes coding for bacteriophage components, sugar metabolism and transport, and exopolysaccharide biosynthesis. One island only found in L. rhamnosus GG contained genes for 3 secreted LPXTG-like pilins (spaCBA) and a pilin-dedicated sortase. Using anti-SpaC antibodies, the physical presence of cell wall-bound pili was confirmed by immunoblotting. Immunogold electron microscopy showed that the SpaC pilin is located at the pilus tip but also sporadically throughout the structure. Moreover, the adherence of strain GG to human intestinal mucus was blocked by SpaC antiserum and abolished in a mutant carrying an inactivated spaC gene. Similarly, binding to mucus was demonstrated for the purified SpaC protein. We conclude that the presence of SpaC is essential for the mucus interaction of L. rhamnosus GG and likely explains its ability to persist in the human intestinal tract longer than LC705 during an intervention trial. The presence of mucus-binding pili on the surface of a nonpathogenic Gram-positive bacterial strain reveals a previously undescribed mechanism for the interaction of selected probiotic lactobacilli with host tissues.
Lactobacillus rhamnosus is a facultatively heterofermentative lactic acid bacterium and is frequently isolated from human gastrointestinal mucosa of healthy individuals. L. rhamnosus ATCC 53103, isolated from a healthy human intestinal flora, is one of the most widely used and well-documented probiotics. Here, we report the finished and annotated genome sequence of this organism.
Lactobacillus rhamnosus esterase D
