Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: lacrh-estB

Lactobacillus rhamnosus (LMS2-1) (HN001) Esterase BLRH_10360

Relationship
Family|BD-FAE
Block| H
Position in NCBI Life Tree|Lactobacillus rhamnosus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Lactobacillales: N E > Lactobacillaceae: N E > Lactobacillus: N E > Lactobacillus rhamnosus: N E


Molecular evidence
Database
No mutation
4 structures (e.g. : 4N5H, 4N5I, 4OUK... more)
No kinetic





No Substrate
3 inhibitors: C4-C4-SN3-tributyrin-phosphonate, C6-C4-Sn3-phosphinate, C8-C4-Sn3-phosphinate
2 Genbank : ACB47389, EDY98960
1 UniProt : B2CZF4
>3 Structure links 1 more: 4N5H, 4OUK, 4PO3
1 UniProt : B2CZF4
1 Interpro : B2CZF4
1 Prodom : B2CZF4
1 Pfam : B2CZF4
1 PIRSF : B2CZF4
1 SUPERFAM : B2CZF4
Sequence
Graphical view for this peptide sequence: lacrh-estB
Colored MSA for BD-FAE (raw)
MADEEAMLAKVQASWAQTAARDKARYADERVPEDVHWETEYRYEQSADPQ
QTLNLYYPAKRRNATMPTVIDIHGGGWFYGDRNLNRNYCRYLASQGYAVM
GMGYRLLPDVDLRGQIQDIFASLRWLSHFGPQRGFDLDHVLLTGDSAGGH
LASLVACIQQSAELQELFGVSRVNFNFTLVALVCPVAEPSKLPEAAGDMS
DMAAFYLDKLSGGDQALVDHLNFSQVVKGLDLPPFMLIGGQNDSFYLQSQ
ALLKVFDANHVTYTTKLWPASAGPHLKHVFNVQHWEWPESIETNLEMLRT
FDALSKQQDQAEENEFE
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MADEEAMLAKVQASWAQTAARDKARYADERVPEDVHWETEYRYEQSADPQ
QTLNLYYPAKRRNATMPTVIDIHGGGWFYGDRNLNRNYCRYLASQGYAVM
GMGYRLLPDVDLRGQIQDIFASLRWLSHFGPQRGFDLDHVLLTGDSAGGH
LASLVACIQQSAELQELFGVSRVNFNFTLVALVCPVAEPSKLPEAAGDMS
DMAAFYLDKLSGGDQALVDHLNFSQVVKGLDLPPFMLIGGQNDSFYLQSQ
ALLKVFDANHVTYTTKLWPASAGPHLKHVFNVQHWEWPESIETNLEMLRT
FDALSKQQDQAEENEFE


Reference
    Title: Esterases of lactic acid bacteria and cheese flavour: Milk fat hydrolysis, alcoholysis and esterification.
    Holland R, Liu SQ, Crow VL, Delabre ML, Lubbers M, Bennett M, Norris G
    Ref: International Dairy Journal, 15:711, 2005 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer