Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: lacsa-a0a2j6ke81

Lactuca sativa (Garden lettuce). Peptidase_S9 domain-containing protein

Relationship
Family|Glutamyl_Peptidase_S9
Block| X
Position in NCBI Life Tree|Lactuca sativa
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > asterids: N E > campanulids: N E > Asterales: N E > Asteraceae: N E > Cichorioideae: N E > Cichorieae: N E > Lactucinae: N E > Lactuca: N E > Lactuca sativa: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : NBSK01007677
1 UniProt : A0A2J6KE81
1 UniProt : A0A2J6KE81
1 Interpro : A0A2J6KE81
1 Pfam : A0A2J6KE81
1 PIRSF : A0A2J6KE81
1 SUPERFAM : A0A2J6KE81
Sequence
Graphical view for this peptide sequence: lacsa-a0a2j6ke81
Colored MSA for Glutamyl_Peptidase_S9 (raw)
MRLHKVYHRFSLFSLTSPPFLPHPSATLFSSYSPSFLSSKRCRISSSTPP
STLNPFLQTMSTSRLHNLVPLAAIATEDAAGPNGSTATPEDDELNSGYRL
PPAEIRDIVDAPPLPALSFSPQRDKILFLKRRSLPPLSELAKPEDKLAGV
RIDGKSNTRSRMSFYTGIGIHDLRDDGTLGPEKLIHGFPDGSKLNFVTWS
TDGRHLAFSIRQDQEEEDDVGSKLRVWVADVETGKAKPLFQSPDVFLNAI
FDNYVWVNDSTLLVCTIPASRGKPPKKPLVPSGPKIQSNEQKTVVQVRTF
QDLLKDEYDEDLFEYYATSQLLLVSLDGSVKLFGEPAVYTSLDPSPDQKY
ILLSSLHRPFSFTVPCGRFPKRIDLWSAADGKFLRTLCDLPVAEDIPIAF
NSVRKGMRSLNWRADKPSTLYWVETQDGGDAKVEVSPRDIVYTQAAEGED
HPSIFHKLDLRYGGISWCDDSLALIYESWYKTRRVRTWLVSPGKSSNENP
PAPRLLFDRSSEDVYSDPGSPMLRRTPDGTYVIAKFKKEDKQATYLLLNG
NGATPEGNIPFLDLFDIDTGEKERIWHSDKEKYYESVVALMSDQKEGELQ
VNELKVLTSKESKTENTQYYIQRWPERKACQITRFPHPYPQLASLQKEMV
RYERKDGVQLTATLYLPPGYDPTRDGPLPCLVWSYPGEFKNKEAAGQVRG
SPNEFAGIGPTSPLLWLARRQFAILSGPTIPIIGEGKEEANDRYVEQLVA
SAEAAVEEVIRRGVAHPGKIAIGGHSYGAFMTANLLAHAPHLFSCGIARS
GAYNRTLTPFGFQNEDRTLWEATDTYIKMSPFMSADKIKKPILLIHGEED
NNSGTLTMQSDRFFNALKGHGALSRLVVLPFESHGYSSRESIMHVLWETD
RWLQKFCVSNSCEEKEDADETKATVASGGGAVAEIEDIGVDTLHYNTRSS
LWFGFICILLGNFVLSLGDFCGTGSMVGDGDRSCCRALILWTETVTGGGV
GHRICERG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRLHKVYHRFSLFSLTSPPFLPHPSATLFSSYSPSFLSSKRCRISSSTPP
STLNPFLQTMSTSRLHNLVPLAAIATEDAAGPNGSTATPEDDELNSGYRL
PPAEIRDIVDAPPLPALSFSPQRDKILFLKRRSLPPLSELAKPEDKLAGV
RIDGKSNTRSRMSFYTGIGIHDLRDDGTLGPEKLIHGFPDGSKLNFVTWS
TDGRHLAFSIRQDQEEEDDVGSKLRVWVADVETGKAKPLFQSPDVFLNAI
FDNYVWVNDSTLLVCTIPASRGKPPKKPLVPSGPKIQSNEQKTVVQVRTF
QDLLKDEYDEDLFEYYATSQLLLVSLDGSVKLFGEPAVYTSLDPSPDQKY
ILLSSLHRPFSFTVPCGRFPKRIDLWSAADGKFLRTLCDLPVAEDIPIAF
NSVRKGMRSLNWRADKPSTLYWVETQDGGDAKVEVSPRDIVYTQAAEGED
HPSIFHKLDLRYGGISWCDDSLALIYESWYKTRRVRTWLVSPGKSSNENP
PAPRLLFDRSSEDVYSDPGSPMLRRTPDGTYVIAKFKKEDKQATYLLLNG
NGATPEGNIPFLDLFDIDTGEKERIWHSDKEKYYESVVALMSDQKEGELQ
VNELKVLTSKESKTENTQYYIQRWPERKACQITRFPHPYPQLASLQKEMV
RYERKDGVQLTATLYLPPGYDPTRDGPLPCLVWSYPGEFKNKEAAGQVRG
SPNEFAGIGPTSPLLWLARRQFAILSGPTIPIIGEGKEEANDRYVEQLVA
SAEAAVEEVIRRGVAHPGKIAIGGHSYGAFMTANLLAHAPHLFSCGIARS
GAYNRTLTPFGFQNEDRTLWEATDTYIKMSPFMSADKIKKPILLIHGEED
NNSGTLTMQSDRFFNALKGHGALSRLVVLPFESHGYSSRESIMHVLWETD
RWLQKFCVSNSCEEKEDADETKATVASGGGAVAEIEDIGVDTLHYNTRSS
LWFGFICILLGNFVLSLGDFCGTGSMVGDGDRSCCRALILWTETVTGGGV
GHRICERG


Reference
    Title: Genome assembly with in vitro proximity ligation data and whole-genome triplication in lettuce
    Reyes-Chin-Wo S, Wang Z, Yang X, Kozik A, Arikit S, Song C, Xia L, Froenicke L, Lavelle DO and Michelmore RW <9 more author(s)>
    Ref: Nat Commun, 8:14953, 2017 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer