Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: legln-d3hkd7

Legionella longbeachae (serogroup 1 (strain NSW150); D-4968) Putative alpha/beta hydrolase

Relationship
Family|abh_upf0017
Block| X
Position in NCBI Life Tree|Legionella longbeachae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Legionellales: N E > Legionellaceae: N E > Legionella: N E > Legionella longbeachae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : FN650140, ACZG01000002
1 UniProt : D3HKD7
1 UniProt : D3HKD7
1 Interpro : D3HKD7
1 Pfam : D3HKD7
1 PIRSF : D3HKD7
1 SUPERFAM : D3HKD7
Sequence
Graphical view for this peptide sequence: legln-d3hkd7
Colored MSA for abh_upf0017 (raw)
MIINSEFKPAKWLKNQHGQTLFRTFTNRLQAPVNFCERVELPDGDFIDLA
WSTGNLNNHSPLIILLHGLGGSINSAYVASLFNSFNRSGYRAVLMNLRGA
NGPNRLPRFYHGGDTSDFAYVLSQLKLREPATKKAVVGISLGGNILLKWL
GETGQQSLIDTAVAVSVPFQLNTAVQKINKGFSRVYQTHLLERLRNLFLQ
KLNIINHQLTLTKQTLLSIKTLYELDEQITAPLNGFSSAHEYYQKSSSRQ
YLWNITTPTLIIHALDDPFMTPDVIPKLHELSSDILLEISQYGGHVGFIA
QNTRYWLEERIPFFLKDHLDSSS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MIINSEFKPAKWLKNQHGQTLFRTFTNRLQAPVNFCERVELPDGDFIDLA
WSTGNLNNHSPLIILLHGLGGSINSAYVASLFNSFNRSGYRAVLMNLRGA
NGPNRLPRFYHGGDTSDFAYVLSQLKLREPATKKAVVGISLGGNILLKWL
GETGQQSLIDTAVAVSVPFQLNTAVQKINKGFSRVYQTHLLERLRNLFLQ
KLNIINHQLTLTKQTLLSIKTLYELDEQITAPLNGFSSAHEYYQKSSSRQ
YLWNITTPTLIIHALDDPFMTPDVIPKLHELSSDILLEISQYGGHVGFIA
QNTRYWLEERIPFFLKDHLDSSS


References
    Title: Analysis of the Legionella longbeachae genome and transcriptome uncovers unique strategies to cause Legionnaires' disease
    Cazalet C, Gomez-Valero L, Rusniok C, Lomma M, Dervins-Ravault D, Newton HJ, Sansom FM, Jarraud S, Zidane N and Buchrieser C <4 more author(s)>
    Ref: PLoS Genet, 6:e1000851, 2010 : PubMed

            

    Title: Virulence factors encoded by Legionella longbeachae identified on the basis of the genome sequence analysis of clinical isolate D-4968
    Kozak NA, Buss M, Lucas CE, Frace M, Govil D, Travis T, Olsen-Rasmussen M, Benson RF, Fields BS
    Ref: Journal of Bacteriology, 192:1030, 2010 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer